RetrogeneDB ID:
retro_ecab_335
Organism:
Horse ( Equus_caballus )
Location:
15:69925403-69925701 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
83.17 %
Coverage:
60.61 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_335
AACCAACAGGCTCAGATCGAGGTGGTACCTTCTGCCTCAGCCCCGCTCATCCAAGCCCTC
AAGGAACCACCAAGAGACAGGAAGCAGAAAAACATTAAGCACAGTGGAAATAGCACCTTT
GATGAGATTGTCAACATTGCCCGACAGATGCAGCACCAGTCATTGGCCAGAGAACTCTGT
GGAACCCTTGAAGAGAACTTGGGGACTGCCTAGTCTGTGGGCTGCAATGTTTATGGTTGA
CACCCTCATGATGGTCATAGATGACATCAACAGTGGTGCAGTGGAATGCCCAGCTAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.46
SRP021940_cerebellum 1.05
SRP021940_embryo 1.41
SRP021940_placental_villous 0.54
SRP021940_synovial_membrane 0.55
SRP021940_testis 1.13

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD-VIDDINNGAVECPA
N.QAQIEVVPSASA..I.ALKEPPRDRK.QKNIKHSGN.TFDEIVNIARQM.H.SLAREL.GT..E.LGTA.SVGCNV.G.HPHD.VIDDIN.GAVECPA
Retrocopy
NQQAQIEVVPSASAPLIQALKEPPRDRK-QKNIKHSGNSTFDEIVNIARQMQHQSLARELCGTLEENLGTA*SVGCNVYG*HPHD\VIDDINSGAVECPA


Parental protein
S
S
Retrocopy
S


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide