RetrogeneDB ID:
retro_ecab_338
Organism:
Horse ( Equus_caballus )
Location:
15:76392359-76392974 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.33 %
Coverage:
62.28 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RDH13
Parental gene aliases:
No gene alias available
Parental gene description:
retinol dehydrogenase 13 (all-trans/9-cis) [Source:HGNC Symbol;Acc:19978]

Genomic region (view in browser)





>retro_ecab_338
TTGAAGGAAGAGCCTAGACTGGACGTCTTGATCAATAACGCAGGCATCTTTCAGTGCCCT
TATATGAAGACCGAAGACGGGTTTGAGATGCAGTTTGGAGTGAACCATCTGGGGCACTTC
CTGCTCACCAATCTTCTCCTTGGACTCCTCAAAAGTTCAGCTCCCAGCAGGATTGTGGTA
GTTTCTTCCAAACTGTATAAATATGGAGACATCAACTTTGAAGACTTGAACAGTGAACAA
AGCTATAATAAAAGCTTTTGTTATAGTCGGAGCAAACTGGCGAACATTCTTTTTACCAGA
GAACTAGCCCGCCGCTTGGAAGGCACAAACGTTACCGTCAATGTGTTACACCCTGGTATT
GTGCGGACTAATCTTGGGAGACACATACACATCCCACTGTTGGTGAAACCACTTTTCAAT
TTGGTATCATGGGCTTTTTTCAAAACTCCAGCAGAAGGTGCCCAGACTTCAATTTATTTA
GCATCATCACCTGAAGTAGAAGGCGTATCAGGAAAGTACTTTGGGGATTGTAAAGAAGAG
GAACTATTGCCCAAAGCTATGGATGAGTCTGTTGCAAGAAAACTCTGGGATATCAGTGAA
GTCATGGTTGGCATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.73
SRP021940_cerebellum 8.02
SRP021940_embryo 5.58
SRP021940_placental_villous 3.85
SRP021940_synovial_membrane 3.23
SRP021940_testis 6.53

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LAEEEQVHVLVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWEKRKYDTKAAYCQSKLAIVLFT
L.EE....VL.NNA....CP...TEDGFEMQFGVN.LGHFLLTNLLL..LK.SAPSRI...SS.....G.I.F.DLN.E...Y.....Y..SKLA..LFT
Retrocopy
LKEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSE-QSYNKSFCYSRSKLANILFT


Parental protein
KELSRRLQGTGVTVNALHPGVARTELGRHTGLHSSAFSSFMLGPIFWLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVARRLWA
.EL.RRL.GT.VTVN.LHPG..RT.LGRH...H.............W...K.P...AQ.S.YLA...E.EGVSGKYF...KE....P.A.DE.VAR.LW.
Retrocopy
RELARRLEGTNVTVNVLHPGIVRTNLGRH--IHIPLLVKPLFNLVSWAFFKTPAEGAQTSIYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWD


Parental protein
ESAHLVGL
.S...VG.
Retrocopy
ISEVMVGI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide