RetrogeneDB ID:
retro_ecab_34
Organism:
Horse ( Equus_caballus )
Location:
6:35625729-35626521 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.37 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS4
Parental gene aliases:
No gene alias available
Parental gene description:
40S ribosomal protein S4 [Source:UniProtKB/Swiss-Prot;Acc:P55832]

Genomic region (view in browser)





>retro_ecab_34
ATGGCTCGTGGTCCCAAGAAGCATCTGAAACGTTTAAGGGCTCCGAAGCAATGGATGCTG
GATAAACTGACCGGAGTGTTTGCTCCTCGGTCCTCTACCCGTCCCCACAAGCTGAGAGAA
TGTCTCCCCGTCGTCATTTTCCTGAGAAACAGACTTAAGTATGGCCTGACGGGAGATGAA
GTAAAGAAGATCTGCATGCGGCGGTTCGTCAAGATTGATGGCAAGGTGCGCACTGATGTA
ACCTACCCTGCTGGTTTTATGGACGTCATCAGCATTGACAAGACTGGAGAGAATTTCCGT
CTGATCTATGACACCAAGGGTCGCTTCGCTGTTCATCGTATTACGCCTGAAGAGGCCAAG
TACAAGTTGTGCAAAGTGAGAAAGACCTTTGTGGGCCCGAAAGGAATCCCTCATCTGGTG
ACCCATGATGCTCGCACCATCCGCTACCCTGATCCTCTCATCAAGGTGAACGACACCATT
CGGATCGACTTGGAGACTGGCAAGATTACTGATTTCATCAAGTTCGACGCTGGGAACGTG
TGTATGGTGACCGGAGGTGCTAACCTGGGAAGAATTGGTGTGATCACCAACAGAGAGAGA
TACCCTGGCTCTTTCGAGGTGGTTCATGTGAAAGATGCCAACGGCAACAGCTTCGCCACC
CGGCTCTCCAACATTTTCGTCATTGGCAAAGGCAACAAACCGTGGATTTCCCTTCCCCGT
GGAAAGGGCATCCGCCTCACCATTGCTGAAGAGAGAGATGTGAGACTGGCAACCAAACAG
AGCAGTGGCTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 14.05
SRP021940_cerebellum 6.22
SRP021940_embryo 13.8
SRP021940_placental_villous 4.16
SRP021940_synovial_membrane 4.69
SRP021940_testis 272.29

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRL
ARGPKKHLKR..APK.WMLDKLTGVFAPR.ST.PHKLRECLP..IFLRNRLKY.LTGDEVKKICM.RF.KIDGKVRTD.TYPAGFMDVISIDKTGENFRL
Retrocopy
ARGPKKHLKRLRAPKQWMLDKLTGVFAPRSSTRPHKLRECLPVVIFLRNRLKYGLTGDEVKKICMRRFVKIDGKVRTDVTYPAGFMDVISIDKTGENFRL


Parental protein
IYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERH
IYDTKGRFAVHRITPEEAKYKLCKVRK.FVG.KGIPHLVTHDARTIRYPDPLIKVNDTI.IDLETGKITDFIKFD.GN.CMVTGGANLGRIGVITNRER.
Retrocopy
IYDTKGRFAVHRITPEEAKYKLCKVRKTFVGPKGIPHLVTHDARTIRYPDPLIKVNDTIRIDLETGKITDFIKFDAGNVCMVTGGANLGRIGVITNRERY


Parental protein
PGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG
PGSF.VVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERD.RLA.KQSSG
Retrocopy
PGSFEVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDVRLATKQSSG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide