RetrogeneDB ID:
retro_ecab_343
Organism:
Horse ( Equus_caballus )
Location:
15:1677925-1678870 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.28 %
Coverage:
56.53 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
WASF1
Parental gene aliases:
No gene alias available
Parental gene description:
WAS protein family, member 1 [Source:HGNC Symbol;Acc:12732]

Genomic region (view in browser)





>retro_ecab_343
GATCATGTGGATGGATTTTATTTTCTTTCTGCCTTGACATTTAGTCAGATGAGTGAACTA
CAGCTGAGAAAAAATTCTTACCCAGACCACAAGAGTCATCTCCACTTCCACCAATGCATG
GAACAGAAGCCGTGAAACCTATACCTACTTGTATCAGTTCTGCTACAGGTTTGATAGAAA
TTTGCCTCAGTCACCAACCATGGTCAGAACTCCTATGTTTGTGAGTCCCACTCCCCACAC
ACTTTGTCCACCACTTCTTCCATCTCCCTTGTCAACTTCTTCATTAAACGCTTCAATGAC
TTCAACTCCTCGCCCACCAGTACTTCCCCCGCCTCCAGCTCCAACTGCTGTTTTGCAAGC
TGCAACAGTACCACCACCTCCAGCTCCTCTTCAGATTGTCCCTGGAGTTCTCCATCCAAC
TCCTTCTCCAACTACACCTCCTCTAGTACAGCCTCTCTACCTGTTGCTAGACCTGTACTG
GTATGTGAGACTGTACCAGTTCATCCACTCCCACAAGCTGAAGTCCAGGGGCTGCTTTCA
CCTCCACCACCTCCCCCTCTGCCTCCACCTCGCATTTGACCATCACCACCTGTCACAGTT
ACAGCTCTTTGTTCATCTTCCCTCTGGGCTATATCCAACAACACCTACTACTGCCCCAAG
TGTCCATGTTCCATTAATGCCTCCATCTCCCCCATCACAAGTTATACCTGTTTCTGAGCC
AAAGTGTCACCAATCAATTATACTTGTAATCGGTGATGCCGAGAACGTATTTCTGGAACC
AAAACAAAAGGTATTCAGCTATGCAAAGTAGAAGAGCAGTGTGGACAGGGAGCTAAACAT
GAACACATTAAAAATGATGTTGCCATCATCCTGTCCCCCTGTATTGCTGTGGAACATAGT
GATTCAGAAGATGATTCAGAATTTGATGAAGGAGATTAGTTGGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DHMDGSYSLSALPFSQMSELLTRAEERVLVRPH-EPPPPPPMHGAGDAKPIPTCISSATGLIE-NRPQSPATGRTPVFVSPTPPP-PPPPLPSALSTSSL
DH.DG.Y.LSAL.FSQMSEL..R.........H..P.PP..MHG....KPIPTCISSATGLIE.N.PQSP...RTP.FVSPTP....PP.LPS.LSTSSL
Retrocopy
DHVDGFYFLSALTFSQMSELQLRKNSYPDHKSH/SPLPP--MHGTEAVKPIPTCISSATGLIE/NLPQSPTMVRTPMFVSPTPHTLCPPLLPSPLSTSSL


Parental protein
RASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQP-SPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRP
.ASMTSTP.PPV.PPPP.P...LQA..VPPPPAPLQI.PGVLHP.P.P..PPLVQP.S.PVAR...VCETVPVHPLPQ.EVQGL..PPPPPPLPPP.I.P
Retrocopy
NASMTSTPRPPVLPPPPAPTAVLQAATVPPPPAPLQIVPGVLHPTPSPTTPPLVQP/SLPVARPVLVCETVPVHPLPQAEVQGLLSPPPPPPLPPPRI*P


Parental protein
SSPVTVAAL-AHPPSGLHP-TPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIR-KGIQLRKVEEQREQEAKHERIENDVATILS
S.PVTV.AL..H.PSGL.P.TP.TAP..HVPLMPPSPPSQVIP.SEPK.H.S...VI.DA..V.LE....KGIQL.KVEEQ..Q.AKHE.I.NDVA.ILS
Retrocopy
SPPVTVTAL\VHLPSGLYPTTPTTAPSVHVPLMPPSPPSQVIPVSEPKCHQSIILVIGDAENVFLEPKQ/KGIQLCKVEEQCGQGAKHEHIKNDVAIILS


Parental protein
RRIAVEYSDSEDDSEFDEVDWLE
..IAVE.SDSEDDSEFDE.D.LE
Retrocopy
PCIAVEHSDSEDDSEFDEGD*LE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide