RetrogeneDB ID:
retro_ecab_345
Organism:
Horse ( Equus_caballus )
Location:
15:16899445-16902387 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.94 %
Coverage:
100.0 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
IPO7
Parental gene aliases:
No gene alias available
Parental gene description:
importin 7 [Source:HGNC Symbol;Acc:9852]

Genomic region (view in browser)





>retro_ecab_345
GGTGTTATCTGTTTGAAAAATATGATAACACAGTATTGACCTGATCGGGAAACAGCACCA
GGGGATATATCCGCTTATACTATTCCCGAAGAAGATCGACATTGTATTCGAGAAAATATT
GTAGAAGCCATTATCTACTCTCCTGAACTTATCAGGGTACAACTTACTACTTGCATTCAT
CATATCATCAAACATGATTATCCAAGCCGCTGGGCTGCCATTGTGGACAAAATTGACTTT
TATCTTCAGTCTGATAACAGTGCTTGTTGGCTAGGAATTCTTCTTTGCCTTTACCAGCTT
GTGAAAAATTATGAGTACAAGAAACCAGAAGAATGGAATCCATTGGTGCAGCAATGCAGC
ATTTCCTGCCAATTCTAAAGGACCATTCTATCCAGCTTCTTTCTGATCAGTCTGATCAAT
CTGTCCTCATTCAGAAAAAAATTTTCAAGATCTTCTTTGCTCTTGTTCAGTATACACTAC
CACTGGAGCTGATAAACCAACAGAACCTGACAGAATGGATAGAAATTTTAAAAACTGTTG
TGAACAGGGATGTACCTAATGAAACACTTCAAGTTGAAGAAGATGATAGACCTGAGTTAC
TGTGGTGGAAATGTAAGAAGTGGGATTTACATATCTTAGCAAGGCTTTTTGAAGGCTATG
GAATCCCTGGCAATGTATGCAAGGAGTATAATGAATTTGCCGAAGTATTTCTGAAGGCGT
TTGCTGTTGGTGTCCAGCAAGTTTTATTGAAGGTGTTGTATCAGTACAAGGAAAAGCATA
TATGGCTCCTCGAGTTTTACAGCAGACATTAAATTATATTAATCAAGGAGTTTCTCATGC
CCTCACCTGGAAGAATCTGAAGCCTCATATACAAGGCATTATCCAAGATGTTATTTTTCC
ATTGATGTGCTAGACAGATGCTGATGAGGAACTTGGGAGGAAGACCCTTATGAATATATA
CGCATGAAGTTTGATGTGTTTGAAGATTTCATTTCTCCTACCACTGCTGCCCAGACACTT
TTGTTTACAGCCTGTAGTAAGAGAAAAGAGGTGCTACAAAAGACTATGGGATTCTGCTAC
CAGATTCTTACTGAACCAAATGCCGATCCTCGAAAAAAAGAAGGAGCCCTGCATATGGTT
GGCTCTTTAGCTGAAATACTTTTGAAGAAAAAGATCTACAAAGATCAGATGGAATACATG
TTGCAGAATCATGTATTCCTTCTCTTCAGCAGTGAACTAGGCTACATGAGAGCAAGGGCT
TGCTTGGTCCTTCATTATTTTTGTGAAGTGAAGTTCAAAAGTGTCCAGAACCTGCAAACA
GCTTTAGAGCTGACACGAAGATGTCTGATTGATGATAGGGAAATGCCTGTGAAAGTGGAA
GCTGCCATTGCACTTCAAGTGTTGATCAGCAATCAAGAAAAAGCTGAAGAATATATCACA
CCGTTCATCAGACCTGTAATGCAGGCTCTTCTTCATATTATAAGAGAAACAGAAAATGAT
GATCTTACCAATGTCATTCAGAAAATGATCTGCGAGTATAGTGAAGAAGTTACTCCTATT
GCAGTAGAAATGACCCAACATTTGGCAATGACATTTAATCAAGTAATCCAGACTGGGCCA
GATGAAGAAGGAAGTGATGACAAAGCAGTTACTGTTATGGGAATCCTGAATACCATCGAC
ACACTTCTTAGTGTAGTTGAAGATCATAAAGAGATAACCCAGCAGCTTGAGGCAATCTGC
TTACAGGTCATTGGAACTGTTTTACAACAGCGTGTCTTAGAATTCTATGAGGAGATCTCT
TTAGCACATAGTTTGACATGTCAGCAGGTGTCTCTGCAGATATGGCAGCTAGTACCTCTG
GTATTTGAAGTTTTTCAGCAAGATTGCTTTGATTACGTCACAGATATGATGCCTCTGCTC
CATAATTATGTAACAGTTGATACAGACACACTTCTGTCTGATACCAACTATCTTGAAATG
ATATACAGTATGTGCAAAAAAGGTTCTTACAGGAGTTGCAGGAGAAGATGCAGAGTGCCA
TGCAGCAAAATTGTTAGAGGTCATCATTCTACAGTGCAAAGGGCATGGCATTGATCAGTG
AATTCCCTTATTTGTGGAAGCAGCTTTAGAGAGACTGACAAGAGAAGTGAAGACAAGTGA
ACTTCGAACAATGTGCCTGCAAGTTGCCATTGCAGCTTTGTATTATAATCCACACCTGCT
TCTCAATACCTTAGAAAATCTTCGCTTCCCTAATAATGTTGAACCAGTTACAAATCATTT
TATCACACAGTGGCTTAATGATGTTGATTGTTTCTTGGGGCTTCATGACAGAAAGATGTG
TGTTCTGGGCCTGTGTGCTTTTATTGATATGGAACAAATACCACAAGTTTTAAATCAGGT
TTCTGGACAGATTTTTGCCAGCTTTTATCCTTTTATTTAATGGATTAAAAAGAGCTTATG
CCTGCCATGCAGAACACGAGAATGACAGTGACGACGATGATGAAGCTGAAGATGATGATG
AAACGGAGGAACTGGGGAGTGATGAAGATGACATTGATGAAGATGGGCGGGAATATTTGG
AGATGCTGGCTAAACAAGCAGGTGAAGATGGAGATGATGAAGACTGGGAAGAAGATGATG
CTGAGGAGACTGCTCTGGAAGGCTATTCTACAATCATTGATGACGAAGATAATCCTGTTG
ATGAGTATCAGATATTTAAAGCTATATTTCAAACTATACAAAGTCGTAATCCTGTGTGGT
ATCAGGCTCTGACTCATGGTCTTAATGAAGAACAAAGAAAACAGTTACAGGATATAGCAA
CTCTGGCTGATCAAAGAGCAGCCCGTGAATCCAAAATGATAGAAAAGCGTGGAGGATACA
AATTCAGTGCTCCAGTTGTGCCAAATTCTTTCAATTTTGGAGGCCCAGCACCAGGGATGA
AT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.0
SRP021940_embryo 0.17
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GVIYLKNMITQYWPDRETAPGDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKHDYPSRWTAIVDKIGFYLQSDNSACWLGILLCLYQL
GVI.LKNMITQY.PDRETAPGDIS.YTIPEEDRHCIRENIVEAII.SPELIRVQLTTCIHHIIKHDYPSRW.AIVDKI.FYLQSDNSACWLGILLCLYQL
Retrocopy
GVICLKNMITQY*PDRETAPGDISAYTIPEEDRHCIRENIVEAIIYSPELIRVQLTTCIHHIIKHDYPSRWAAIVDKIDFYLQSDNSACWLGILLCLYQL


Parental protein
VKNYEYKKPEERNPLV-AAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYALVQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPE
VKNYEYKKPEE.NPLV.AAMQHFLP.LKD..IQLLSDQSDQSVLIQK.IFKIF.ALVQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPE
Retrocopy
VKNYEYKKPEEWNPLV/AAMQHFLPILKDHSIQLLSDQSDQSVLIQKKIFKIFFALVQYTLPLELINQQNLTEWIEILKTVVNRDVPNETLQVEEDDRPE


Parental protein
LPWWKCKKWALHILARLFERYGSPGNVSKEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEKQ-YMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGIIQDV
L.WWKCKKW.LHILARLFE.YG.PGNV.KEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEK..YMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGIIQDV
Retrocopy
LLWWKCKKWDLHILARLFEGYGIPGNVCKEYNEFAEVFLKAFAVGVQQVLLKVLYQYKEKH/YMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGIIQDV


Parental protein
IFPLMCYTDADEEL-WQEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILTEPNADPRKKDGALHMIGSLAEILLKKKIYKDQ
IFPLMC.TDADEEL.W.EDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILTEPNADPRKK.GALHM.GSLAEILLKKKIYKDQ
Retrocopy
IFPLMC*TDADEEL/WEEDPYEYIRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILTEPNADPRKKEGALHMVGSLAEILLKKKIYKDQ


Parental protein
MEYMLQNHVFPLFSSELGYMRARACWVLHYFCEVKFKSDQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAKEYITPFIRPVMQALLHIIRE
MEYMLQNHVF.LFSSELGYMRARAC.VLHYFCEVKFKS.QNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKA.EYITPFIRPVMQALLHIIRE
Retrocopy
MEYMLQNHVFLLFSSELGYMRARACLVLHYFCEVKFKSVQNLQTALELTRRCLIDDREMPVKVEAAIALQVLISNQEKAEEYITPFIRPVMQALLHIIRE


Parental protein
TENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAMGILNTIDTLLSVVEDHKEITQQLEGICLQVIGTVLQQHVLEFY
TENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVT.MGILNTIDTLLSVVEDHKEITQQLE.ICLQVIGTVLQQ.VLEFY
Retrocopy
TENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTVMGILNTIDTLLSVVEDHKEITQQLEAICLQVIGTVLQQRVLEFY


Parental protein
EEIFSLAHSLTCQQVSPQMWQLLPLVFEVFQQDGFDYFTDMMPLLHNYVTVDTDTLLSDTKYLEMIYSMC-KKVLTGVAGEDAECHAAKLLEVIILQCKG
EEI.SLAHSLTCQQVS.Q.WQL.PLVFEVFQQD.FDY.TDMMPLLHNYVTVDTDTLLSDT.YLEMIYSMC.KKVLTGVAGEDAECHAAKLLEVIILQCKG
Retrocopy
EEI-SLAHSLTCQQVSLQIWQLVPLVFEVFQQDCFDYVTDMMPLLHNYVTVDTDTLLSDTNYLEMIYSMC\KKVLTGVAGEDAECHAAKLLEVIILQCKG


Parental protein
RGIDQCIPLFVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLGLCALIDMEQIP
.GIDQ.IPLFVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLGLCA.IDMEQIP
Retrocopy
HGIDQ*IPLFVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDVDCFLGLHDRKMCVLGLCAFIDMEQIP


Parental protein
QVLNQVSGQI-LPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIID
QVLNQVSGQI.LPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDG.EYLE.LAKQAGEDGDDEDWEEDDAEETALEGYSTIID
Retrocopy
QVLNQVSGQI\LPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGREYLEMLAKQAGEDGDDEDWEEDDAEETALEGYSTIID


Parental protein
DEDNPVDEYQIFKAIFQTIQSRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN
DEDNPVDEYQIFKAIFQTIQSRNPVWYQALTHGLNEEQRKQLQDIATLADQ.RAA.ESKMIEK.GGYKFSAPVVP.SFNFGGPAPGMN
Retrocopy
DEDNPVDEYQIFKAIFQTIQSRNPVWYQALTHGLNEEQRKQLQDIATLADQ-RAARESKMIEKRGGYKFSAPVVPNSFNFGGPAPGMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide