RetrogeneDB ID:
retro_ecab_347
Organism:
Horse ( Equus_caballus )
Location:
15:33094633-33095245 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.0 %
Coverage:
64.49 %
Frameshifts:
7
Stop codons:
1


Parental gene:
Parental gene symbol:
CCDC94
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 94 [Source:HGNC Symbol;Acc:25518]

Genomic region (view in browser)





>retro_ecab_347
TTTGACCAGTCAAAGATCCTCAAGCTCAGGGTCCCCAGGACTGGCACCATGTGGTGCGGT
CAACGGCCCCTTCAGCCCGACGTGTGAGACCTGAGGAGAATACAGCTACGGGGGAAAGAA
ATTCGACGCGCAAAGAGAGGGCGCAGAACAGGCCTCCAGGGACCCGCCCACCTTCCGTTT
CCGCTTCCGGTTCTGTTTCCGTACGTCGAGTGCGTGCGCTACCAGGCAGACAGCACCTTC
AAGACAGACCCCGAAGGCACGGACTGCACCGTGGAGCACAGGGCTACAGGGAACTTCCAG
GCCGAGAAGCCCCTGGAGCAGGAGGAGAAGAGGCTGCGGGAGGACGAGGGGCTGAGCAAC
CCCATGAAAGTTGCTGGAGAGACCAACCCAAAGCCTCAGGCTGGGATGGAGACTGGAGAA
CCTGCAGGAGCTCGAGGACCTGAGCCGGCGGAGGCCCCCAGGGACTTTGAGGCCGCACTG
CGGCAGCACCGCCTGCGAGGAGGACGGGCAGGAGCAGGAGGAGGACGAGAGGGAGACGGC
GGCCTTAGTGGAAGAAGCTAGCAAACGAAGACCGCTGGAGACTCCCATTCAGAGGAGGAT
GCTGCTGCTCCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FDPSKIPKLKLPK-DRQYVVRLMAP-FNMRCKTCGEYIY-KGKKFN----ARKETVQNEAYLG--LPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGAT
FD.SKI.KL..P..D...VVR..AP.F...C.T.GEY.Y..GK........R....Q..A.L...LP....Y..C.R..A..TFKTDPE.TD.T.EH.AT
Retrocopy
FDQSKILKLRVPR/DWHHVVRSTAP/FSPTCET*GEYSY/RGKEIRRAKRGRRTGLQGPAHLPFPLPVLFPYVECVRYQADSTFKTDPEGTDCTVEHRAT


Parental protein
RNFQAEKLLEEEEKRVQKEREDEELNNPMKV-LENRTKDSKLEMEVLENLQELKDLNQR-QAHVDFEAMLRQHRL-SEEERQKQEQEEDERETAALVEES
.NFQAEK.LE.EEKR....REDE.L.NPMKV.LE..T....L....LENLQEL.DL..R..A..DFEA.LRQHRL..E......E...DERETAALVEE.
Retrocopy
GNFQAEKPLEQEEKRL---REDEGLSNPMKV\LERPTQSLRLGWR-LENLQELEDLSRR/EAPRDFEAALRQHRL\EEDGQEQEE---DERETAALVEEA


Parental protein
RKRRLLE-DSDSEEEDAPAP
.KRR.LE.DS.S.EEDA.AP
Retrocopy
SKRRPLE/DSHS-EEDAAAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide