RetrogeneDB ID:
retro_ecab_35
Organism:
Horse ( Equus_caballus )
Location:
9:22543066-22543816 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
100.0 %
Coverage:
98.42 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
60S ribosomal protein L7 [Source:RefSeq peptide;Acc:NP_001157336]

Genomic region (view in browser)





>retro_ecab_35
ATGGAGGGCGCGGAGGAGAAGAAGAAGAAGAAGCTCCCTGATGTACCAGAAACCCTTAAG
AAAAAGCGAAGGAATTTCGCAGAGCTGAAGATCAAGCGCCTGAGAAAGAAGTTTGCCCAA
AAGATGCTTCGAAAGGCAAGGAGGAAGCTCATCTATGAAAAAGCTAAGCACTATCACAAG
GAGTATAGGCAGATGTACAGAACTGAGATCCGAATGGCTAGGATGGCAAGAAAAGCTGGC
AACTTCTATGTACCTGCGGAACCCAAATTGGCGTTTGTCATCAGGATCAGAGGTATCAAT
GGTGTGAGCCCAAAGGTCCGAAAGGTGTTGCAGCTGCTCCGCCTTCGCCAGATCTTCAAC
GGCACGTTTGTTAAGCTCAACAAGGCTTCAGTTAACATGCTGAGGATTGTGGAACCGTAT
ATCGCATGGGGGTACCCGAACCTGAAGTCAGTAAATGAATTGATCTACAAGCGTGGTTAT
GGCAAAATTAACAAGAAGCGAATTGCCCTGACAGATAACTCATTGATTGCTCGATCTCTG
GGTAAATTTGGCATCATTTGCATGGAGGATCTGATTCATGAGATCTATACTGTTGGGAAA
CGTTTCAAAGAAGCGAACAACTTCCTGTGGCCCTTCAAACTATCTTCTCCACGAGGGGGA
ATGAAGAAGAAGACCACCCACTTTGTAGAAGGTGGAGATGCTGGCAACAGGGAAGACCAG
ATCAACAGGCTTATTAGGAGGATGAACTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.31
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEGAEEKKKKKLPDVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGIN
MEGAEEKKKKKLPDVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGIN
Retrocopy
MEGAEEKKKKKLPDVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGIN


Parental protein
GVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGK
GVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGK
Retrocopy
GVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGK


Parental protein
RFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN
RFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN
Retrocopy
RFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide