RetrogeneDB ID:
retro_ecab_355
Organism:
Horse ( Equus_caballus )
Location:
16:1308788-1309689 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.85 %
Coverage:
68.41 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
PSMC1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Source:HGNC Symbol;Acc:9547]

Genomic region (view in browser)





>retro_ecab_355
TTATCAAAGTTAAGGAGAATTAAAGACTATCTTCTCATGGAGGAAGAATTCATTAGAAAT
CAGGAACAAATGAAGCCTTTAGAAGAAAAGCAAGGGGAGGAAAGATGAAAGGTGGATGAT
CTAAGGGGGACCCCAATGTTGGTAGGAGCCTTAGAAGAGATCATTGATGACAATCACGCT
GTCATGTCTACATCTGTGGGCTCAGGACACTACATCAGCATTCTTTCATTTGTAGCCAAG
GATCTGCTGGAACCAGGCTGCTTGGTCCTGTTCAGCCATAAGGTGCATGCCGTGATAGAG
GTGCTGATGGGTGACACAGGTCCCCTGGTCACAGTGATGAAGGTGGAAAAGGCCCCCAGG
AGACCTGTGCTGATATTGGGGGCTTGGGCAACAAAACCCATGAAATTAGGAAATCTCTGG
AGCTTCCTTTCACTCATCCTGAATATTATGAAGAGAGGGATATAAAGGCCCCTAAGGGGG
TCATTCTCTATGGTCCACCTGGCACATGTAAAACCTTACTAGCCAATGCAGTAGCAAACT
AAACCTCAGCCACTTTCTTGAGTGTGGTTGGTTCTGAATTTATTCAGAAGTACCTGGGTG
ATGAGCCCAAACTCGTACAGGAATTGTTTCAAGTTGCTGAAGAACATGTACCATCCATCG
TATTTATTGATAAAATTGATGCCATTGGGACAAAAAGATATGACTCAAATTCTGGTGGTG
AGAGAGAAATTCAGCAAATAATGTTGGAACTGTTGAACCAGTTGGATGGATTTGATTCAG
GGGAGATGTGAAAGTTATCATGGCCGCAAACCACATAGAAAATTTGGATCCAGCACTTAT
CAGACCAGGCCACACTGACAGGGAGATCAAACTCCTCCTGCCCAATGAAAGGACTAATAA
G

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIG
L.KL.RIKDYLLMEEEFIRNQEQMKPLEEKQ.EER.KVDDLRGTPM.VG.LEEIIDDNHA..STSVGS.HY.SILSFV.KDLLEPGC.VL..HKVHAVI.
Retrocopy
LSKLRRIKDYLLMEEEFIRNQEQMKPLEEKQGEER*KVDDLRGTPMLVGALEEIIDDNHAVMSTSVGSGHYISILSFVAKDLLEPGCLVLFSHKVHAVIE


Parental protein
VLMDDTDPLVTVMKVEKAP-QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYL
VLM.DT.PLVTVMKVEKAP.QET.ADIGGL.N...EI..S.ELP.THPEYYEE..IK.PKGVILYGPPGT.KTLLA.AVAN.TSATFL.VVGSE.IQKYL
Retrocopy
VLMGDTGPLVTVMKVEKAP/QETCADIGGLGNKTHEIRKSLELPFTHPEYYEERDIKAPKGVILYGPPGTCKTLLANAVAN*TSATFLSVVGSEFIQKYL


Parental protein
GDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDS-RGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEK
GD.PKLV.ELF.VAEEH.PSIVFID.IDAIGTKRYDSNSGGEREIQ..MLELLNQLDGFDS.RGDVKVIMA.N.IE.LDPALIRPG..DR.I...LP.E.
Retrocopy
GDEPKLVQELFQVAEEHVPSIVFIDKIDAIGTKRYDSNSGGEREIQQIMLELLNQLDGFDS/RGDVKVIMAANHIENLDPALIRPGHTDREIKLLLPNER


Parental protein
TKK
T.K
Retrocopy
TNK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide