RetrogeneDB ID:
retro_ecab_359
Organism:
Horse ( Equus_caballus )
Location:
16:37185001-37185501 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
89.29 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
ISCU
Parental gene aliases:
No gene alias available
Parental gene description:
iron-sulfur cluster scaffold homolog (E. coli) [Source:HGNC Symbol;Acc:29882]

Genomic region (view in browser)





>retro_ecab_359
ATGGTCGCGGCTGGAGCGGGCCGTCTGAGGCAGCGGCACCGGCCCTGCTGCTGCGGTGCC
TGCCCCTGCCCGCCTGGGAGCTGTCAGCTCTGGCCGGGCTCTATCACAAGAAGGTTGTTG
ACCATTATGAAAATCCTAGAAATGTAGGGTCCCTTGACAAGACATCTAAAAATGTTGGAA
CTGGATTAGTGGGGGCTCCAGCATGTGGCGATGTGATGAAACTACAGATTCAAGTGGACG
AAAAGGGGAAGATGGTGGACGCCCGGTTTAAAACGTTTGGCTGTGGTTCTGCCATTGCCC
CCAGCTCGTTAGCCACCGAGTGGGTCAAAGGGAAGACGGTGTAGGAAGCCTTGACCATCA
AAAACACAGACATCGCCAAGGAACTCTGCCTTCCTCCTGTGAAACTGCACTGCTCCATGC
TGGCTGAAGATGCAATCAAGACCACCCTTGCTGATTACAAGCTGAAACAAGAACCCAAGA
AAGGCGAGGCGGAGAGGAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.35
SRP021940_cerebellum 0.65
SRP021940_embryo 0.74
SRP021940_placental_villous 0.36
SRP021940_synovial_membrane 0.34
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAAGAGRLRR-AASALLLRSPRLPARELSAPARLYHXQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAI
M.AAGAGRLR..AA.ALLLR...LPA.ELSA.A.LYH..VVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGK.VDARFKTFGCGSAI
Retrocopy
MVAAGAGRLRQ/AAPALLLRCLPLPAWELSALAGLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKMVDARFKTFGCGSAI


Parental protein
ASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
A.SSLATEWVKGKTV.EALTIKNTDIAKELCLPPVKLHCSMLAEDAIK..LADYKLKQEPKKGEAE.K
Retrocopy
APSSLATEWVKGKTV*EALTIKNTDIAKELCLPPVKLHCSMLAEDAIKTTLADYKLKQEPKKGEAERK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide