RetrogeneDB ID:
retro_ecab_360
Organism:
Horse ( Equus_caballus )
Location:
16:41618421-41618609 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.83 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
SHFM1
Parental gene aliases:
No gene alias available
Parental gene description:
split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845]

Genomic region (view in browser)





>retro_ecab_360
ATGTCAGAGAAAACGCAGCCAGTAGACTTAGGTCTCCTGAAGGAGGACGAGTTCCCTGCG
GAAGACAAGGCTGGTTTAGATGAAGATGCACATGTCTGGGAGGATAATTAGGATGATAAC
AATGTACAGGATGACTTCTCCAGTTATGAGCCGAACTAGAGAAACATGGTTATAAGATGG
AGACCTCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.22
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSN-QLRAELEKHGYKMETS
MSEK.QPVDLGLL.E.....EFPAED.AGLDED..AHVWEDN.D.DN...D....QL.AELEKHGYKMETS
Retrocopy
MSEKTQPVDLGLLKE----DEFPAEDKAGLDED--AHVWEDN*D-DNNVQDDFS/QL*AELEKHGYKMETS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide