RetrogeneDB ID:
retro_ecab_361
Organism:
Horse ( Equus_caballus )
Location:
16:45791698-45792853 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.85 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RAD23B
Parental gene aliases:
No gene alias available
Parental gene description:
RAD23 homolog B (S. cerevisiae) [Source:HGNC Symbol;Acc:9813]

Genomic region (view in browser)





>retro_ecab_361
GTGAAAGCACTGGAGGAGAAGATCGAGTCTGAAAAGGGGAAAGATGCCTTTCCTGTAGCA
GGTCAAAAATTAATTTATGCAGGCAAAATCCTCAATGATGATACTGCTCTAAAGGAATAT
AAAATTGATGAGAAAAACTTTGTGGTGGTTATGGTGACAAAACCCAAAGCAGTGACAACA
CCAGCACCAGCTACAACACAGCAATCAAATTCTGCCACCACTACCACATAGTTCCTCCAC
AGCACCAGCTGTGGCTCAGGCTCCAACCCCCGCCCCTGCCTTGGCTCCCACTCCCACCCC
TGCATCCATCACTCCAGCATCAGCAACAGCATCTTCTGAACCTGCACCTGCTAGTGCAAC
GAAACAAGAGAAACCTGCAGAAAAGCCAGCAGAAACACCAGTGGCTACTAGCCCAACATC
AACTGACTGTACATCAGGAGATTCTTCTCGGTCAAACCTTTTTGAAGATGCAACAAGTGC
GCTTGTGACAGGTCAGTCTTATGAGAATATGGTAGCAGAGATCATGTCAATGGGCTGTGA
ACGAGAGCAAGTAATTGCGGCCCTGAGAGCCAGTTTCAACAACCCTGACAGAGCAGTGGA
GTATCTTTTCATGGGAATCCCTGGAGACAGAGAGAGTCAGGCTGTGGTTGACCCCCCTCC
AGCAGCTAGTACTGGGGCTCCTCAGTCTTCAGTGGCTGCAGCTGCAGCAACCACGACAGC
GACGACTACAACAACAAGTTCTGGAGGACATCCCCTTGAATTTTTACGGAATCAGCCTCA
ATTTCAACAGATGAGAAAATTATTCAACAGAATCCTTCCCTGCTTCCAGCATTGCTACAA
CGGATAGGTCGGGAAGATCCTCAGTTACTTCAGCAAATTAGCCAACACCAGGAGCATTTT
ATACAGATGTTAAATGAACTGGTTCAAGAAGCTGGTGGTCAAGGAGGAGGGGGTGGAGGG
GGCAGTTGAGGAATTGCAGAAGCTGGAAGTGGTCATATGAACTACATTCAAGTAACGCCT
CAGGAAAAAGAAGCTATAGAAAGGCTAAAGGCTTTGGGATTTCCTGAAGGACTTGTGATA
CAAGCATATTTTGCCTGTGAGAAGAACGAGAACTTGGCTGCCAAGTTTCTTCTACAGCAA
AACTTTCATGAAGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.93
SRP021940_cerebellum 1.74
SRP021940_embryo 3.93
SRP021940_placental_villous 3.17
SRP021940_synovial_membrane 1.22
SRP021940_testis 0.83

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVTTPAPATTQQSNSATTTTV-SSSTAPAAAQAPTPAPALAPAP
VKAL.EKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVTTPAPATTQQSNSAT.TT..SSSTAPA.AQAPTPAPALAP.P
Retrocopy
VKALEEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVTTPAPATTQQSNSAT-TTT\SSSTAPAVAQAPTPAPALAPTP


Parental protein
TPASITPASTTASSEPAPASATKQEKPAEKPAEAPVATSPTSTDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRA
TPASITPAS.TASSEPAPASATKQEKPAEKPAE.PVATSPTSTD.TSGDSSRSNLFEDATSALVTGQSYENMV.EIMSMG.EREQVIAALRASFNNPDRA
Retrocopy
TPASITPASATASSEPAPASATKQEKPAEKPAETPVATSPTSTDCTSGDSSRSNLFEDATSALVTGQSYENMVAEIMSMGCEREQVIAALRASFNNPDRA


Parental protein
VEYLLMGIPGDRESQAVVDPPPAASTGAPQSSVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMR-QIIQQNPSLLPALLQQIGRENPQLLQQISQHQ
VEYL.MGIPGDRESQAVVDPPPAASTGAPQSSVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMR..IIQQNPSLLPALLQ.IGRE.PQLLQQISQHQ
Retrocopy
VEYLFMGIPGDRESQAVVDPPPAASTGAPQSSVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMR/KIIQQNPSLLPALLQRIGREDPQLLQQISQHQ


Parental protein
EHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
EHFIQMLNE.VQEAGGQGGGGGGGS.GIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAA.FLLQQNF.ED
Retrocopy
EHFIQMLNELVQEAGGQGGGGGGGS*GIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAAKFLLQQNFHED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide