RetrogeneDB ID:
retro_ecab_362
Organism:
Horse ( Equus_caballus )
Location:
16:45933568-45933815 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.76 %
Coverage:
82.0 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
HMGN1
Parental gene aliases:
No gene alias available
Parental gene description:
high mobility group nucleosome binding domain 1 [Source:HGNC Symbol;Acc:4984]

Genomic region (view in browser)





>retro_ecab_362
CAGCTCCGTGGAGGGCACGGAGGAGGAACCCAGGAGATGGCAAGGTTGTCAGCTAAACCT
GCTCCTGCAAAAGTGAAAACGAAACCCAAAAAGGAGTCCGAAAAAGGCCGTGGGGAAGGA
TAAATCTTCAGACAAAAATGTGCAAACCAAAGGGGAAAAGGGGGGCAAAAGGAAAACAGG
CCGGAGTGACTAACCAGAGCCTAAAGAAGACTTCCCTGCAGAAAACCGAGACTCTGACGG
GCAGGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QVSSAEGAAKEEPKRRSARLSAKPAPAKVETK-PKKVAGKDKSSDKKVQT-KGKRGAKGKQAEVANQ-ETKEDLPAENGETKNEE
Q.....G....E..R.SA.........K.....PKK..GKDKSSDK.VQT.KGKRGAKGKQA.V.NQ.E.KED.PAEN......E
Retrocopy
QLRGGHGGGTQEMARLSAKPAPAKVKTKPKKE\PKKAVGKDKSSDKNVQT\KGKRGAKGKQAGVTNQ/EPKEDFPAENRDSDGQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide