RetrogeneDB ID:
retro_ecab_367
Organism:
Horse ( Equus_caballus )
Location:
16:73233929-73235092 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.26 %
Coverage:
61.98 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
DLGAP5
Parental gene aliases:
No gene alias available
Parental gene description:
discs, large (Drosophila) homolog-associated protein 5 [Source:HGNC Symbol;Acc:16864]

Genomic region (view in browser)





>retro_ecab_367
CCGGCCACAGGAGCGACGCGTGATAAAGAAACAGAAAGAAAAGTACCCAATCAAGGAAGG
CCTGCCAAAAAGATAGAAAGAAAACCTGGCAAGGTCGTTTCCTTTAAAGTTGATAGTGAA
GAAAATACTTTGGAGTCACAAACCAATGTGACAAACGGAACGGATCCAGATGGAGTCTTA
TCAAAAATGGAAAAGTTACCTAAGTCAAATCCTGCAGCAGTGAAAGGGAGGCCATCCTTC
GCACCAGTAGATTTCGTATTTCGGCCTCCAGATGGTCTGAAGAGCTATGAGATAACACCT
AGGAAGCCCACAAAAACCACTGCGTGGACGCCCGCTTACAGCTGCAGCTCTTTAAACACG
GAAGTTGATAAGGCTCTAGAAGCAACAAAAGAAATTTTGGCACAGAAATGTAAACCTTCA
GCACATCAAGATTACGATGAATTTCGCCGTCCTTTGCGCTCCCTAGCAGTCGGGAGCACA
GATCGTGTCTTAAAGAAAAATGAAACTACTACTGAAAATCTACATGGCCTTCCAATAAAA
GAAGTCCCATCACTTGAAATAAATGAGGATCAGACATCTCAGCAACCACACGTGCTGTAT
TTCAGAAATATTCTCCAGTCAGAAACTGAAAAACTAACTTCACACTGCCTTGAGTGGGAA
AGGAAGCTTGAATTGGACATTCCAGATGAAGCCAAAGACCTTATTCGCCTGGCAGTTGGT
CAAACAAGACTCCTTATGAAAGAAAGGTTCAAACAGTTTGAAGAACTGGTGGACAATTGT
GACTATAAACGAGGAGAAAAGGATACCACCTGTACAGACCTGGATGGCTTTTGGGATATG
GCTAGCCTTCAGATATGGGATGTAAACCAAAAATTCAACAATCTGACCAAACTGGAGGAG
TGTGAATGGCAAAACAATAATAATACAAGCAAAAAAGTCTTTCAGAAAAAAGTTGTTTCG
GGTATAGCAAGTAAACCAAAACAGGACGATGCTGGGAGAATTGCAGCCAGAAGTCGCCTC
GCTGCTGTGAAGAAGGCAGTGAGAGAGAGGATGCACGGGGAGAGCAGGCCGAGGCCGAGG
GCTCTGCAGCGCCGAAGGAAGTTGATCAAATAGTGTTTGACGCTGGATTTTTTAGAATTG
AAAGTCCCGTTAAATCGTTCTCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.92
SRP021940_cerebellum 7.67
SRP021940_embryo 2.35
SRP021940_placental_villous 0.76
SRP021940_synovial_membrane 1.77
SRP021940_testis 1.54

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PATRAARDNETERKVPNQGRPAKKIERKPGKVVSFKVDSEENTLESQTIVTNGMDPDGVLSKMEKLPKTNPAAVKGRPSFAPVDFVFRPPDGLKSYEITP
PAT.A.RD.ETERKVPNQGRPAKKIERKPGKVVSFKVDSEENTLESQT.VTNG.DPDGVLSKMEKLPK.NPAAVKGRPSFAPVDFVFRPPDGLKSYEITP
Retrocopy
PATGATRDKETERKVPNQGRPAKKIERKPGKVVSFKVDSEENTLESQTNVTNGTDPDGVLSKMEKLPKSNPAAVKGRPSFAPVDFVFRPPDGLKSYEITP


Parental protein
RTPTSTAAWTPTYSCSSLNTEVDKAPEATKETLAQKCKPSAHQECDGWRRPLSSLAVGSTDRVLNKNETTTENLHGLPIKEVPSLEINEDQTSQPRHVLY
R.PT.T.AWTP.YSCSSLNTEVDKA.EATKE.LAQKCKPSAHQ..D..RRPL.SLAVGSTDRVL.KNETTTENLHGLPIKEVPSLEINEDQTSQ..HVLY
Retrocopy
RKPTKTTAWTPAYSCSSLNTEVDKALEATKEILAQKCKPSAHQDYDEFRRPLRSLAVGSTDRVLKKNETTTENLHGLPIKEVPSLEINEDQTSQQPHVLY


Parental protein
FRSILQSETEKLTSHCLEWERKLELDVPDEAKDLIRLAVGQTRLLMKERFKQFEELVDDCEYKRGEKDTTCADLDGFWDMVSLQVRDVNQKFNNLTKLEE
FR.ILQSETEKLTSHCLEWERKLELD.PDEAKDLIRLAVGQTRLLMKERFKQFEELVD.C.YKRGEKDTTC.DLDGFWDM.SLQ..DVNQKFNNLTKLEE
Retrocopy
FRNILQSETEKLTSHCLEWERKLELDIPDEAKDLIRLAVGQTRLLMKERFKQFEELVDNCDYKRGEKDTTCTDLDGFWDMASLQIWDVNQKFNNLTKLEE


Parental protein
CEWQNNNNTSKKVFQKKVVSGLASKPKQDDAGRIAARSRLAAVKKAVRERMQ-RGEQAGAAGSAVPKEVDQIVFDAGFFRIESPVKSFS
CEWQNNNNTSKKVFQKKVVSG.ASKPKQDDAGRIAARSRLAAVKKAVRERM..RGEQA.A.GSA.PKEVDQIVFDAGFFRIESPVKSFS
Retrocopy
CEWQNNNNTSKKVFQKKVVSGIASKPKQDDAGRIAARSRLAAVKKAVRERMH/RGEQAEAEGSAAPKEVDQIVFDAGFFRIESPVKSFS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide