RetrogeneDB ID:
retro_ecab_368
Organism:
Horse ( Equus_caballus )
Location:
16:75770593-75771140 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.91 %
Coverage:
96.35 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL9
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L9 [Source:HGNC Symbol;Acc:10369]

Genomic region (view in browser)





>retro_ecab_368
ATGAAGACCATTCTCAGCAATCAGAATGTCGACGTTCCAGAGAATGCCGACATCACTCTG
AAGGGACGCACAGTTCTTGTGAAGGGCCCCAGAGGAACCCTGCAGAGGGGCTTCAGTCAC
ACCACTGTAGAACTGAGTCCCCTGGGAAAGAGGAAGAGGCTCCAGCTTGACAAACGGTAG
GAAATTGAAAGGACCGGGCTACCACTGGCGCTCTGTGTGTCAGGTGCAGAGCGTGAAGGA
GGGTGTTACCCTGGGCTTCCATTACAAGATGAGCTCAGAGTATGCTCACGTCCCCATCAA
TGTCATTTTTCAGCAGAATGGGTCTCTTGCTGAAATCTGAAATTTCTTGTGCAAAAAATA
TATCTGCAGGGTTCGGATGAGGCCAGGCAATACTTAAGTATCTCAAGCCCAGAAAGATGA
GCTAATTCTTGAAGGAAATGGCAATGGACTTGTATCCAATTCAGCTGCTTTGATTCAGCA
AGCCACAACAATTAGAAACAAGGATATGAGAAAATGTTTGCATGGTGTCTGTATCAGTGC
CCTAGGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDK-WWGNRKELATVRTIC-SHVQNMIKGVTLGFRYKMRSVYAH
MKTILSNQ.VD.PEN.DITLKGRTV.VKGPRGTL.R.F.H..VELS.LG.K.KRL..DK...GN.K..AT....C...VQ....GVTLGF.YKM.S.YAH
Retrocopy
MKTILSNQNVDVPENADITLKGRTVLVKGPRGTLQRGFSHTTVELSPLG-KRKRLQLDK/TVGN*KDRATTGALC/CQVQSVKEGVTLGFHYKMSSEYAH


Parental protein
FPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKG
.PINV..Q.NGSL.EI.NFL..KYI.RVRMRPG....VSQAQKDELILEGN...LVSNSAALIQQATT..NKD.RK.L.G...S..G
Retrocopy
VPINVIFQQNGSLAEI*NFLCKKYICRVRMRPG-NT*VSQAQKDELILEGNGNGLVSNSAALIQQATTIRNKDMRKCLHGVCISALG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide