RetrogeneDB ID:
retro_ecab_37
Organism:
Horse ( Equus_caballus )
Location:
23:27294517-27297835 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.24 %
Coverage:
99.81 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
IPO5
Parental gene aliases:
IPO5, RANBP5
Parental gene description:
importin 5 [Source:HGNC Symbol;Acc:6402]

Genomic region (view in browser)





>retro_ecab_37
ATGGCGGCGACCGGGTCTGCAGGGATACCGGCGACCGTGTCGGGAAAGCAAGAGTTTTAC
CAGCTTTTGAAGAACCTGATAAATCCAAGCTGTATGGTCCGGAGGCAGGCAGAGGAAATC
TATGAAAATATCCCAGGTCTGTGTAAGACTACATTCCTCTTAGATGCTGTCAGAAATAGA
AGAGCAGGTTATGAGGTGAGACAAATGGCAGCCGCACTGCTACGACGGCTTTTGTCCTCT
GGGTTTGAGGAAGTCTATCCAAATCTCCCCTCTGATGTTCAGAGGGACGTCAAGATTGAA
CTGATCCTGGCTGTTAAATTAGAAACACATGCTAGCATGAGGAAAAAACTTTGTGATATT
TTTGCAGTGCTGGCCAGGAATTTGATAGACGAGGATGGCACTAACCACTGGCCTGAAGGT
CTGAAGTTCCTTATTGATTCAATCTACTCTAAAAATGTGGTTCTCTGGGAGGTTGCACTT
CACGTTTTCTGGCACTTTCCTGGGATTTTTGGGAACCAAGAGCGGCACGATTTGGATATC
ATCAAACGGTTGTTGGACCAGTGTATTCAAGATCAAGAACATCCAGCAATCAGGACGTTA
TCTGCTAGAGCCGCCGCTGCATTTGTACTTGCTAATGAGAATAATATTGCTCTTTTCAAA
GACTTTGCAGACTTGCTTCCTGGAATCTTACAGGCTGTGAATGATTCATGCTACCAGGAT
GATGATTCTGTGCTAGAATCCCTTGTTGAGATTGCAGATACTGTACCTAAATACTTGGGT
CCTTATTTAGAAGATACTCTGCAGTTGAGTCTAAAGTTGTGTGGAGACTCTAGACTTAGT
AATCTGCAACGCCAACTGGCCCTTGAAGTTATAGTGACCTTGTCTGAAACTGCAACCCCA
ATGTTAAAAAAACATACAAATATTATTGCACAAGCAATTCCTCATATATTAGCAATGATG
GTTGATCTACAAGATGATGAGGACTGGGTAAATGCTGATGAAATGGAAGAAGATGATTTT
GACAGCAATGCAGTTGCTGCTGAGAGTGCACTAGACAGATTGGCTTGTGGGCTCGGAGGA
AAACTTGTTTTACCAATGACTAAGGAGCATATCATGCAGATGCTTCAGAGCCCAGACTGG
AAATATCGACATGCTGGATTAATGGCCTTATCTGCCATTGGAGAAGGATGCCATCAGCAA
ATGGAATCAATTCTAGATGAAACAGTTAACTCTGTTTTGCTTTTTCTTCAGGATCCGCAT
CCTAGGGTGAGGGCTGCAGCCTGTACTACACTTGGACAGATGGCCACAGATTTTGCACCT
AACTTCCAAAAGAAATTCCATGAAACAGTGATTGCAGCTCTGTTGCGTACCATGGAGAAT
CAAGGTAATCAGCGTGTGCAATCACATGCAGCTTCCGCGCTTATTATTTTTATTGAAGAC
TGCCCCAAATCATTGCTAGTTCTATATTTGGATAGTATGGTGAGAAATCTGCATTCCATC
TTGGTGATTAAACTTCAAGAGTTGATTCGGAATGGAACTAAGTTGGCCTTGGAACAGCTT
GTGACAACCATTGCCTCAGTTGCGGATACTATAGAAGAAAAGTTTGTTCCCTATTATGAC
ATATTTATGCCCTCACTAAAGCACATTGTTGAACTCGCTGTTCAAAAGGAACTCAAGCTT
CTGAAAGGAAAAACTATTGAATGTATTAGTCATGTTGGTCTTGCTGTTGGGAAGGAAAAA
TTTATGCAGGATGCATCAAATGTGATGCAGCTATTATTGAAGACACAATCAGACTTAAAT
AATATGGAAGATGATGACCCTCAGACCTCTTACATGATTTCAGCATGGGCTCGAATGTGT
AAAATTCTTGGAAATGATTTTCAGCAGTACCTTCCATTGGTTATTGAGCCTCTTATTAAG
ACTGCTTCAGCTAAACCTGATGTCGCTCTCTTAGACACACAAGACGTGGAGAATATGAGT
GATGATGATGGATGGCAATTTGTAAATCTTGGAGACCAGCAAAGTTTTGGAATTAAAACT
TCAGGACTTGAAGCAAAAGCAACTGCTTGCCAGATGTTGGTTTACTATGCTAAGGAGTTA
AGGGAAGGCTTTGTGGAATATACAGAACAAGTTGTAAAGCTGATGGTTCCTTTACTGAAA
TTTTATTTCCATGACAATGTTCGAGTGGCAGCAGCAGAGTCCATGCCTTTTCTCCTGGAA
TGTGCAAGAACTCGTGGCCCAGAGTATCTTGCACAGATGTGGCAATTCATATGTGATCCC
TTAATCAAGGCTATTGGGACTGAACCTGATACAGATGTACTGTCAGAAATAATGAATTCT
TTTGCAAAGTCCATTGAAGTAATGGGAGATGGGTGCCTTAATGATGAACACTTGGAAGAA
CTGGGAGAAATATTGAAAGCAAAACTTGAAGGGCACTTTAAAAATCAAGAATTGAGACAG
GTTAAAAGACAGGAAGAAAACTATGACCAGCAGGTTGAAATGTCTCTGCAAGATGAAGAT
GAATGTGATGTTTATATTCTGACCAAAGTATCAGATATTTTGCACTCATTATTTAGTACT
TATAAGGAAAAGATTTTACCATGGTTTGAACAGCTGCTCCCATTAATTGTAAATCTAATT
TGTTCCAGTAGGCCATGGCCAGACAGACAGTGGGGATTGTGCATATTTGACGATATCATA
GAGCACTGCAGTCCAACCTCTTTTAAATATGTAGAATATTTTCGGTGGCCAATGCTACTA
AATATGCGAGACAACAACCCTGAAGTCAGGCAAGCTGCTGCTTATGGCCTGGGTGTTATG
GCACAGTTTGGTGGAGATGACTATCGTTCTTTATGTTCAGAAGCTGTTCCACTGCTGGTA
AAAGTTATTAAGTGTGCAAATTCCAAAACCAAAAAAAATGTCATTGCTACAGAGAACTGT
ATCTCAGCAGTAGGGAAGATTTTGAGGTTTAAGCCTAACTGTGTAAATGTAGATGAAGTT
CTTCCACACTGGTTATCATGGCTTCCACTGCATGAAGATAAAGAGGAAGCTATTCAGACT
TTGAGTTTTCTCTGTGACTTAATTGAAAGTAACCATCCAGTTGTACTTGGTCCAAATAAT
TCCAATCTTCCCAAAATAATCAGTATAATTGCAGAAGGAAAAATTAATGAGACTATTAAC
TATGAAGATCCTTGTGCCAAACGCCTAGCTAATGTCGTGCGTCAGGTACAGACTTCTGAA
GAACTCTGGTTGGAATGCGTATCCCAACTTGATAATGAGCAGCAGGAAGCCTTACAGGAG
TTGCTAAATTTTGCTTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 10.05
SRP021940_cerebellum 5.38
SRP021940_embryo 20.39
SRP021940_placental_villous 8.41
SRP021940_synovial_membrane 6.15
SRP021940_testis 1.6

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPTLPSDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDED
VR.QAEE.YENIPG..K.TFLL.A.RN..A..E.RQMAA.LLRRLLSS.F.EVYP.LPSDVQ...K.EL......ET..SMRKK.CDI.A.LARNLIDED
Retrocopy
VRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSDVQRDVKIELILAVKLETHASMRKKLCDIFAVLARNLIDED


Parental protein
GNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQA
G.N.WPEGLKFL.DS..S.N..L.E.ALH.FW.FPGIFGNQ..H.LD.IKR.L.QC.QDQEHP.IRTLSARA.AAF.LANE.N.ALFK.FADLLPG.LQA
Retrocopy
GTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGNQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFKDFADLLPGILQA


Parental protein
VNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTSLNNMQRQLALEVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANA
VNDSCYQ.DDSVL.SLVEIADTVPKYL.P.LE.TLQLSLKLCGD..L.N.QRQLALEVIVTLSETA..ML.KHTNI.AQ.IP..LAMMVDL..DEDW.NA
Retrocopy
VNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAIPHILAMMVDLQDDEDWVNA


Parental protein
DELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVG
DE.E.DDFDSNAVA.ESALDR.ACGLGGKLVLPM.KEHIMQMLQ.PDWKYRHAGLMALSAIGEGCHQQME.IL.E.VN.VLLFLQDPHPRVR.AAC...G
Retrocopy
DEMEEDDFDSNAVAAESALDRLACGLGGKLVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLG


Parental protein
QMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDNLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAE
QMATDFAP.FQKKFHE.VIAALL.TME.QGNQRVQ.HAA.ALI.F.EDCPKSLL..YLD..V..LHSI.V.KLQELI..GTKL.LEQ.VT.IASVADT.E
Retrocopy
QMATDFAPNFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKSLLVLYLDSMVRNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIE


Parental protein
EKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFSDMEDDDPQISYMISAWARMCKILGKEFQQYLP
EKFVPYYD.FMPSLKHIVE.AVQKEL.LL.GKTIECIS..GLAVGKEKFMQDAS.VMQLLLKTQ.D...MEDDDPQ.SYMISAWARMCKILG..FQQYLP
Retrocopy
EKFVPYYDIFMPSLKHIVELAVQKELKLLKGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMISAWARMCKILGNDFQQYLP


Parental protein
VVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDGVRVAAA
.V..PL.KTAS.KP.VALLDTQD.ENMSDDDGW.FVNLGDQQSFGIKT.GLE.K.TACQMLV.YAKEL.EGFVEYTEQVVKLMVPLLKFYFHD.VRVAAA
Retrocopy
LVIEPLIKTASAKPDVALLDTQDVENMSDDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLKFYFHDNVRVAAA


Parental protein
ESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIMHSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQV
ESMP.LLECAR.RGPEYL.QMW.F.CD.LIKAIGTEPD.DVLSEIM.SFAK.IEVMGDGCLN.EH.EELG.ILKAKLE.HFKNQELRQVKRQ.E.YD.QV
Retrocopy
ESMPFLLECARTRGPEYLAQMWQFICDPLIKAIGTEPDTDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGEILKAKLEGHFKNQELRQVKRQEENYDQQV


Parental protein
EESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPMLQYVCDNSPEVRQA
E.SLQDED..DVYILTKVSDILHS.FS.YKEK.LPWFEQLLPLIVNLIC..RPWPDRQWGLCIFDD.IEHCSP.SFKY.EYF..PML....DN.PEVRQA
Retrocopy
EMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLICSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQA


Parental protein
AAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADSKTKENVNATENCISAVGKIMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFSYLCDLIESNH
AAYGLGVMAQ.GGD.YR..C.EA.PLLV.VI..A.SKTK.NV.ATENCISAVGKI..FKP.CVNV.EVLPHWLSWLPLHEDKEEA.QT.S.LCDLIESNH
Retrocopy
AAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAVGKILRFKPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLSFLCDLIESNH


Parental protein
PIVLGPNNTNLPKIFSIIAEGEMHEAIKHEDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA
P.VLGPNN.NLPKI.SIIAEG...E.I..EDPCAKRLANVVRQVQTS..LW.EC..QL..EQQ.A.QELLN.A
Retrocopy
PVVLGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEELWLECVSQLDNEQQEALQELLNFA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide