RetrogeneDB ID:
retro_ecab_371
Organism:
Horse ( Equus_caballus )
Location:
16:15701996-15702962 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.21 %
Coverage:
60.15 %
Frameshifts:
0
Stop codons:
7


Parental gene:
Parental gene symbol:
CLPTM1L
Parental gene aliases:
No gene alias available
Parental gene description:
CLPTM1-like [Source:HGNC Symbol;Acc:24308]

Genomic region (view in browser)





>retro_ecab_371
TACCTCCTTATCCTGTTCATTGAACAGCTCAGCAATCGAGTAAAGGACTTCACGGTCATA
TCCTGTTCCACCACCGAGCTGCCCCTTGCAGTGTCCTAGGACAGGATCTCACTGGGAAGG
CTCTGCATCTCGATCCACATGCAGGATGCCGTGTACTTCCTGCAGCAGTTCGGGTTTTCA
GAGAAAGATGTTGATGAAAGAAAGGGAATTGTTCTTGATACCAACTTGTACTTCTTAGCA
TTGAACTTCTTTGTCACAGCATTTCACTTTCTTCTTGATTTCCTGGCCTTTAAAAATGAT
ATCAGTTTCCAGAATAAAAAGAAGAGCATGATTGGGATGTCTCCCAAAGCAGTGCACTGG
TGCTGCTTCAGTACGGTGGCCATCTTCCTGTCCCTGCCGGACAAGCAGACGAGCCTCCTG
GGGCTGGTCTCGGTGGGCATCGGAGCTGCCATCGAGCTATGAAAAGTGAAAAAGGCATTG
AAAATGACTTATTTGAGAATCCTAAGACCTGAGTTTTAGTTTGCCACTTACAGTGAACCT
GAAAGGAAAACCAAAGAATATGACACCTGGGCCATGAGGTATTTGCATTACCTGCTCTGC
ATTCCATGTATCCAGGGTGCTATCTATTTGCTGCAGAACAACAAGTATAATCGTTGATAT
TCTCAGTTGATCAACAGCTTCATCAATAGGGTATATGCTTTTGGCTTCCTCTTTGTGCTG
CTAGAGCTCTTTGTGAACTAAAAGATGAAGTCGGCAGTGTACCTGCCCAGGAAAGCCTTC
ACCTATAAGAACTTCAGCACCTTCATTGATGATGTCTTTGCCTTCATCATCATCATGCCC
ACCTCCCACCAGCTGGTGTGTTTCAGGGACGATGTGGTGTTCCTTGTTTAGCTCTAGCAA
CAATGGCTTTATCCAGGGAGCAAGAGCAGAGTGGATGAATTTGGTGAGTCCTGCAAGGAG
AAGCCG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKISLGRLRFWIHMQDAVFSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKND
YL.ILFI.QLSNRVKD..VI..STTELPL.VS.D.ISLGRL...IHMQDAV..LQQFGFSEKD.DE.KGI..DTNLYFLAL.FFV.AFH.L.DFLAFKND
Retrocopy
YLLILFIEQLSNRVKDFTVISCSTTELPLAVS*DRISLGRLCISIHMQDAVYFLQQFGFSEKDVDERKGIVLDTNLYFLALNFFVTAFHFLLDFLAFKND


Parental protein
ISFWKKKKTMIGMSTKAGLMACFLGIFSVLLWVDDQTSLLVLVPAGIRSAIELWKVKKALKMTVVWRGLRPQFQFGTYSESERKTEEYDTQAMRYLSYLL
ISF..KKK.MIGMS.KA....CF......L...D.QTSLL.LV..GI..AIEL.KVKKALKMT...R.LRP.F.F.TYSE.ERKT.EYDT.AMRYL.YLL
Retrocopy
ISFQNKKKSMIGMSPKAVHWCCFSTVAIFLSLPDKQTSLLGLVSVGIGAAIEL*KVKKALKMTYL-RILRPEF*FATYSEPERKTKEYDTWAMRYLHYLL


Parental protein
YPLCVGGAVYSLLNVKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLY
...C..GA.Y.L.N.KY...YS.LINSF.N.VYAFGFLF.L..LFVN.KMKS...LP.KAFTYK.F.TFIDDVFAFII.MPTSH.L.CFRDDVVFLV.L.
Retrocopy
CIPCIQGAIYLLQNNKYNR*YSQLINSFINRVYAFGFLFVLLELFVN*KMKSAVYLPRKAFTYKNFSTFIDDVFAFIIIMPTSHQLVCFRDDVVFLV*L*


Parental protein
QRWLYPVDKSRVNEFGESYEEKP
Q.WLYP..KSRV.EFGES..EKP
Retrocopy
QQWLYPGSKSRVDEFGESCKEKP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide