RetrogeneDB ID:
retro_ecab_375
Organism:
Horse ( Equus_caballus )
Location:
16:35447681-35447915 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
58.23 %
Coverage:
50.32 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
DUT
Parental gene aliases:
No gene alias available
Parental gene description:
deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:3078]

Genomic region (view in browser)





>retro_ecab_375
GCCTGGCCTGTGGAGAAGGATGGCACGTGGCTCCACTTTATCTGCCTCTTGGAGCATGTG
ACAGCCCCGACCAGAGGGTCCTTGAAGGTCACATGCTATGACCTGTAGAGTACCTAGGAT
TCTAGAGTACATATGGAGAAAACTCTCATGAAAACAGACATTAAGATGGCTCTTCCTTCT
GGGTGTTACAGAAGAGTAGTTCCACATTCTGGCTTGGATGCAAAACTCTTCATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.65
SRP021940_embryo 0.5
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.42
SRP021940_testis 0.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARPAEGSGMRLRFTRLSEHATAPTKGSARAAGYDLYSAYDYTVPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFI
A.P.E..G..L.F..L.EH.TAPT.GS.....YDL.S..D..V..MEK.L.KTDI..ALPSGCY.RV.P.SGL.AK.FI
Retrocopy
AWPVEKDGTWLHFICLLEHVTAPTRGSLKVTCYDL*ST*DSRVH-MEKTLMKTDIKMALPSGCYRRVVPHSGLDAKLFI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide