RetrogeneDB ID:
retro_ecab_377
Organism:
Horse ( Equus_caballus )
Location:
16:37386066-37386678 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.94 %
Coverage:
95.33 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL14
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L14 [Source:HGNC Symbol;Acc:10305]

Genomic region (view in browser)





>retro_ecab_377
TTCATGGAGGTTGGCTGGGTGACCTACGTCTCCTTTGGGCCTCATGCAGGGAAGCTGGTT
GCGACTGTAGATGTTATTGATCAGAACAGGACTTTGGTCGATGGTCCTTGCACTCAGGTG
AGGAGACAAGCTATGTCTTTTAAATACATGCAGCTCACTGACTTCATCCTATAGTTTCCA
CACAGTGCCCGCCAGAAGTACATCCAACAAGCCTGGCAGAAGGCAGATATCAATACAAAC
TGGGCAACCACAAGATGGGCCAAGAAGATGGAAGCCAGAAAAAGGAAAGCCAAGATGACA
GATTTTGATGGTTTTAAAGTCATGAAGGCAAAGAAAATGAAGAACAGAATAATCAAGTTT
GAAGTCAGGAAGCCTCAAAAGGAAGGTCTCCTGAAAGCTTCTCCCAAGAAATAATCTGCT
GCTAAGGGTGCAGCTGCAACAACTGCTGCAGAGGTTCCAGCAAAAAAGATGACTGCTGTG
GGCCAGAAGGCTCCAGCCCGGAAGGTTCCTGCCAAGAAAGCTGCAGGCCAGAAGACAGCA
CCTCTGAAAGCTCAGAATGGTCAGACAGCTCCAGCCCAGAGAGCACCTGCTCCAAAGGCG
TCTGGCAAGAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 8.54

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FVEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSARQKYVRQAWQKADINTKWAATRWAKKIEARERKPKMT
F.EVG.V.YVSFGPHAGKLVA.VDVIDQNR.LVDGPCTQVRRQAM.FK.MQLTDFIL.FPHSARQKY..QAWQKADINT.WA.TRWAKK.EAR.RK.KMT
Retrocopy
FMEVGWVTYVSFGPHAGKLVATVDVIDQNRTLVDGPCTQVRRQAMSFKYMQLTDFIL*FPHSARQKYIQQAWQKADINTNWATTRWAKKMEARKRKAKMT


Parental protein
DFDRYKVMKAKKMRNRIIKLEVRKLQKAALLKASPKKAPAAKGAAATAAAKVPSKKTTTAGKKAPAQKAPAQKAAGQKAAPPKAQKGQKAPGQKTPAQKA
DFD..KVMKAKKM.NRIIK.EVRK.QK..LLKASPKK..AAKGAAAT.AA.VP.KK.T..G.KAPA.K.PA.KAAGQK.AP.KAQ.GQ.AP.Q..PA.KA
Retrocopy
DFDGFKVMKAKKMKNRIIKFEVRKPQKEGLLKASPKK*SAAKGAAATTAAEVPAKKMTAVGQKAPARKVPAKKAAGQKTAPLKAQNGQTAPAQRAPAPKA


Parental protein
PAPK
...K
Retrocopy
SGKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide