RetrogeneDB ID:
retro_ecab_383
Organism:
Horse ( Equus_caballus )
Location:
16:51281085-51281958 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.94 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
SLC25A30
Parental gene aliases:
No gene alias available
Parental gene description:
solute carrier family 25, member 30 [Source:HGNC Symbol;Acc:27371]

Genomic region (view in browser)





>retro_ecab_383
ATGGCGGCCCTCAACCGGAAGCCCTTTGTGTACGGAGGGCTGGCCTCCATCCCGGCAGAA
TGCGGTACATTCCCAATTGATTTAACCAAGATGTGGCTCCAGATTCAATGGCAGACGAAC
GACGCCAACTTGAAAGAAATCCGGTACAGAGGCGTGTTGCATGCTTTCGTGACGATAGGC
CGAGAGGAAGGGCTGAAAGCGCTGTAGGTCGGGATTGCCCCCGCGATGCTACGCCAGGCT
TCCTATGGCACCGTCAAGATAGGCACTTAGCAGAGCTTGAAGCGATTATTTGTCGAACGC
CCAGAAGGTGAGACTCTACTGATAAATGTGGTCTGTGGAATTCTCTCTGGAGTCCTATCC
TCAGCCATTGCTAATCCAACTGATGTTTTGAAAATACGGATGCAAGCACAAAGCAGCAGC
ATTCAGGGAGGAATGATAGGCAGCTTCATTAACAATTACCAGCAAGAGGGACCGAGAGGA
CTGTGGAAGGGCGTGTCCCTTACCGCTCAGAGGGCTCCTATTGTTGTTGGCTTGGAGCTG
CGGGTCTGCGACCTCGCCAAGAAGCATCTGATCCTCTGGGGCCTGATGGGAGACCCTGTG
TCTACCCACTTCCTCTCAAGCTTCACCTGAGGTCTGGCCGGGGCCCTGGCCTCAAACCCT
GTCGAAGTTGTGAGAACACCTGTGATGAATCAGAGAGTCCTTCGAGATGGCACATGCTGT
GGCTACACGGGTACCCTGGATTGCTTGTTACAGACTTGGAAGAATGAAGGGCTTTTTGCT
CTATATAAAGGGTTTTGGCCAAATTGGTTGAGACTTGGACCTTGGAACATCATTTTCTTT
GTGACATGTGAGCGGCTGAAGAAACTGGATTTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.15
SRP021940_embryo 0.05
SRP021940_placental_villous 1.3
SRP021940_synovial_membrane 0.68
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVER
M.ALN.KPFVYGGLASI.AECGTFPIDLTK..LQIQ.QTNDAN.KEIRYRG.LHA.V.IGREEGLKAL..GIAPAMLRQASYGT.KIGT.QSLKRLFVER
Retrocopy
MAALNRKPFVYGGLASIPAECGTFPIDLTKMWLQIQWQTNDANLKEIRYRGVLHAFVTIGREEGLKAL*VGIAPAMLRQASYGTVKIGT*QSLKRLFVER


Parental protein
PEDETLLINVVCGILSGVISSTIANPTDVLKIRMQAQSSTIQGGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDLTKKHLILSGLMGDTV
PE.ETLLINVVCGILSGV.SS.IANPTDVLKIRMQAQSS.IQGGMIG.FIN.YQQEG.RGLWKGVSLTAQRA.IVVG.EL.V.DL.KKHLIL.GLMGD.V
Retrocopy
PEGETLLINVVCGILSGVLSSAIANPTDVLKIRMQAQSSSIQGGMIGSFINNYQQEGPRGLWKGVSLTAQRAPIVVGLELRVCDLAKKHLILWGLMGDPV


Parental protein
YTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGSCPGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL
.THFLSSFT.GLAGALASNPV.VVRT..MNQRVLRDG.C.GYTGTLDCLLQTWKNEG.FALYKGFWPNWLRLGPWNIIFFVT.E.LKKLDL
Retrocopy
STHFLSSFT*GLAGALASNPVEVVRTPVMNQRVLRDGTCCGYTGTLDCLLQTWKNEGLFALYKGFWPNWLRLGPWNIIFFVTCERLKKLDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide