RetrogeneDB ID:
retro_ecab_384
Organism:
Horse ( Equus_caballus )
Location:
16:52947060-52947430 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.31 %
Coverage:
99.2 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
C2orf76
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 2 open reading frame 76 [Source:HGNC Symbol;Acc:27017]

Genomic region (view in browser)





>retro_ecab_384
TCTGAAGAAGTGACCACTACAGGTCACCTCTTCGTTCTGTTGAACATCGCAATTTCAAAT
CTGTAATATATCATGGAGTTAATTTGGACGAAACTGCAAAGGGATTTATAGTATTTCTGA
AGCAAGATGTTTCTTTAAGATCAATCTGCCACCACCATTCGGAAATTATAAATATGATAA
ACTAAAGATTATCCATCAAGCACATAAGTCAAAGACAAATGAACTTGTGTTGAGTTTGGG
AAACGATGGCACAACTCCCGTTATAAGAAAACAGTGCTTTGAAAGCAGCTGGAATTGCCA
ATGATACTGAAATTCATTCTCCTGTGAAGAAGATTATACGAACTACAAAGCTAATCCCAT
TTCATCCTGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASEVTVTVRL-IRSFEHRNFRPVVYHGVNLDQTVKEFIVFLKQDIPLRT-SLPPPFRNYKYDKLKIIHQAHKSKTNELVLSLEDDD-RLLLKEDGTLQAA
..EVT.T..L..RS.EHRNF..V.YHGVNLD.T.K.FIVFLKQD..LR...LPPPF.NYKYDKLKIIHQAHKSKTNELVLSL..D...L.L.E...L.AA
Retrocopy
SEEVTTTGHL/LRSVEHRNFKSVIYHGVNLDETAKGFIVFLKQDVSLRS/NLPPPFGNYKYDKLKIIHQAHKSKTNELVLSLGNDG\QLPL*ENSALKAA


Parental protein
GIANETEI-AFFCEEDYKNFKANPVSSW
GIAN.TEI..F.CEEDY.N.KANP.SSW
Retrocopy
GIANDTEI/SFSCEEDYTNYKANPISSW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide