RetrogeneDB ID:
retro_ecab_385
Organism:
Horse ( Equus_caballus )
Location:
16:55228719-55229322 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.56 %
Coverage:
91.4 %
Frameshifts:
2
Stop codons:
7


Parental gene:
Parental gene symbol:
FAM60A
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 60, member A [Source:HGNC Symbol;Acc:30702]

Genomic region (view in browser)





>retro_ecab_385
TTTTGTAAGCCAAAGATGTACTGATGTATAGAGGGCTGCTGGATTTACAGAGCTAGGTTC
TCCGCTTCTCAATTTAGTGACAGTGAATGATGAAAGGACTTCCAGAGCTGTTTGCAGATG
AATGAGACTCCTTCAGAAGATGTTTGCAGTGGTTGAGTACTACTTGTGAAAAGATAGAAA
AAGCTGCCAGCTGGATAAAAATGAAAACAAGACTGGAATCATGTGGCAGATAAAAGGGCA
GGACCCAGTCTAAACTCTATATTGAAACCAAAGAAAGTGAAAACTCTATTTGGAAATAGG
ATAAAGAAGCAACCAGGCCAGTAAACTACAGGAAGGATTTCAGCCTCACAATTCTGATGC
CCCGGGTACCACCTCAGGTACTTCTCCAGCCCAATTTCCTTGTTGCAGTTACCAGTCAGA
CGATGGCTCTAATACAGAGATGGCTTCTGGTTCTAACACGTGTCTTTTCCTGTTTAATCT
CGTGTGTTGGAAAAGGCAGAACATATGTTGTGGGTTTACCTATAAGAGGCATTTTGCAGT
AGTCCTCCTTGACACACATCTCTTAAGCTTTGCTGCATCAATAAGAAAGCAGCTTCTGAG
AGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAG--SKKNWNHVVDARAGPSLKTTLKPKKVKTLSGN
F.KPKMY..IEGC.I.RA..S.S.F.DS.....DFQSC....ET.S.D.C...VLLVKR.KKLPAG...K..WNHV.D.RAGPSL...LKPKKVKTL.GN
Retrocopy
FCKPKMY*CIEGCWIYRARFSASQFSDSE**K-DFQSCLQMNETPSEDVCSG*VLLVKR*KKLPAG*K*KQDWNHVADKRAGPSLNSILKPKKVKTLFGN


Parental protein
RIK-SNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHL-FKPCCSNK
RIK.SNQ.SKLQ..F..HNSDA..TTS..SPAQ.PC.S.QSDDGS.TEMASGSN.T..F.F..L..WKRQ.ICCG..YK..F..VL.DTHL..K.CC.NK
Retrocopy
RIK\SNQASKLQEGFQPHNSDAPGTTSGTSPAQFPCCSYQSDDGSNTEMASGSN-TCLFLF-NLVCWKRQNICCGFTYKRHFAVVLLDTHL/LKLCCINK


Parental protein
KAAAEK
KAA.E.
Retrocopy
KAASER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide