RetrogeneDB ID:
retro_ecab_386
Organism:
Horse ( Equus_caballus )
Location:
16:55884774-55885374 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.25 %
Coverage:
66.45 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
BABAM1
Parental gene aliases:
No gene alias available
Parental gene description:
BRISC and BRCA1 A complex member 1 [Source:HGNC Symbol;Acc:25008]

Genomic region (view in browser)





>retro_ecab_386
TCCAACACTGAGGGGGCTGAGGACCAGGCACTGGAGGCCCAGGCCAGGCTGGGCAGCCAC
AGTAAGGCAGAGGATGAGGCAGCCAGTGCTGATGAGGACTCCGAGCCCTCCAGGAGCTGG
CTCCAATCCCTGGCAGGAGTCCCTGCTTGTCCCTGAGGTCCAGGTGCAGATGCCAACGGC
CAACTGTCCAGAAGGTGATCATCTGCCTGGACCTGTTGAAGGAAATGTTGCTGCTAAAGC
TGGAGTCGTTCAACAGCACCAAGATCAACGTGCTCAACGTCTCCCAGGAGATGAGGATAA
AATACAAGAACAAAAGCCACGAATTCAGGCTGGTGGTGCTGAACGAGGACACAGCCTGGC
TGTCTGGCCTGACCTCCAGCCCCCACAAGCACGGCAGCTGCCTCTAGACCTGGAGATAGC
CTTTTGTTCCATCTTCAATCTAGAAGGTCTCTTCAGCCTCATCCAGAAGAAGACTGAGCT
GCCAGTCACTAAGCACTTGTAGACGATCCCCTGCCAAGTGTGGTCCACACCATCCTTGTC
TACAGCTGTTTGCTGTGCCAGCCCCAGGTCTCCCTGCAGCGAGTGAAGAAATGTTCCAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SNPEGAEDRALGAQASVGSRSEGEGEAASADDG-TPNPPGAG-PKPWQVPPPAPEIQVRTPRVNCPEKVILCLDLSEEMALPKLESFNGSKTNALNVSQK
SN.EGAED.AL.AQA..GS.S..E.E.A...D..TP.PPGAG.P.P...P........R..R.....KVI.CLDL..EM.L.KLESFN..K....NV...
Retrocopy
SNTEGAEDQALEAQARLGSHSKAEDE-AASADE\TPSPPGAG\PIPGRSPCLSLRSRCRCQRPTV-QKVIICLDLLKEMLLLKLESFNSTK---INVLNV


Parental protein
MIEMFVRTKHKIDKSHEFALVVVNDDIAWLSGLTSDPRELCSCL-YDLETASCSAFNLEGLVSLIQQKTELPVTENVQTI-PPPYVIRTILVYSRPPCQP
..EM....K....KSHEF.LVV.N.D.AWLSGLTS.P....SCL..DLE.A.CS.FNLEGL.SLIQ.KTELPVT....TI.P.P.V..TILVYS...CQP
Retrocopy
SQEMRIKYKN---KSHEFRLVVLNEDTAWLSGLTSSPHKHGSCL/LDLEIAFCSIFNLEGLFSLIQKKTELPVTKHL*TI/PLPSVVHTILVYSCLLCQP


Parental protein
QHGVTRVPNAGK
Q....RV.....
Retrocopy
QVSLQRVKKCSR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide