RetrogeneDB ID:
retro_ecab_388
Organism:
Horse ( Equus_caballus )
Location:
16:75978104-75978677 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.74 %
Coverage:
94.58 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL13A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L13a [Source:HGNC Symbol;Acc:10304]

Genomic region (view in browser)





>retro_ecab_388
ATGGTGGAGGGGCAGGTCCTGGTTCTAGATGGCTGAGGCCTTCTCTGGGGCCACGTGGCA
GTCACTGTACCCAAGCAAGGGCTGCTGGACCAGAGGTGGTGGTTGTGCAATGTGAGGGCA
CCAACATTTCTGGCAATTTCTACAGAAACAAGTTGAAGCACCTGGCTTTCCTCCAAAAGC
AGATGGACACAACCCATCCCGTGGCTCCTACCACTTCCGAGGCCCCAGCTGTATCTCTTG
GCGAACCATGCGAGGCACACTGCCCCACAGGCACAAGTGAGGTCACACGGCCCAGGACCT
CCCCAAGGTACCTGATGGCATCCCACCACCCTACAACAAGAAAGAGCGAATGGTGGCTCC
CACTGCCCTCAAGGTTGTATGTCTGAAGCCTGCACGAAAGCCTGCCTCCCTGGGGCACCT
GGCTCTTGAGGTGGGCTGGAAGCACCAGGCAGTTACAGCCACTCAGAGGAGAAGAGGAAG
GAGGAGGCCAAGATCCATTACCAGAAGAAATAACAGCTCATCAGACCATGGAAACAGGCT
GAAGAGAACATGGAGAGGAAAACTGACAAATAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.15
SRP021940_embryo 0.53
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.36
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAEGQVLVLDGRGHLLGRLAAIVAKQVLL-GRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT-NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAA
M.EGQVLVLDG.G.L.G..A..V.KQ.LL.G..VVVV.CEG.NISGNFYRNKLK.LAFL.K.M.T.NPSRG.YHFR.PS.I.WRT.RG.LPH..K.G..A
Retrocopy
MVEGQVLVLDG*GLLWGHVAVTVPKQGLL/GPEVVVVQCEGTNISGNFYRNKLKHLAFLQKQMDT/NPSRGSYHFRGPSCISWRTMRGTLPHRHK*GHTA


Parental protein
LDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTAT-LEEKRKEKAKIHYRKKKQLTRLRKQAEKNVEKKIDRY
.D..KV.DGIPPPY.KK.RMV.P.ALKVV.LKP.RK.A.LG.LA.EVGWK.QAVTAT..EEKRKE.AKIHY.KK.QL.R..KQAE.N.E.K.D.Y
Retrocopy
QDLPKVPDGIPPPYNKKERMVAPTALKVVCLKPARKPASLGHLALEVGWKHQAVTAT/SEEKRKEEAKIHYQKK*QLIRPWKQAEENMERKTDKY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide