RetrogeneDB ID:
retro_ecab_389
Organism:
Horse ( Equus_caballus )
Location:
17:5108466-5109259 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
87.41 %
Coverage:
99.63 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_389
ACGAAGGTTTTGGGAACAGTAAAATGGTTCAACGTAAGAAACGGATATGGCTTCATCAAG
AGGAATGACACCACGGAAGATGTATTTGTACACCACACTGCCATAAAGAATAACCCCAGG
AAGCACCTTCGCAGTATAGGAGATGGAGAGACACTGGAGTTTGATGTTATTGAAGGAGAA
AAGGGTGCGGAGGCAGCAAGTTACAGGCCCTGGGGGGGTTCCAGAGCAAGGCAGTAAATA
CGCAGCAGACCTGAACCATTATAGACGCTATCCACGTCGCAGGGGTCCTCCACGCAACTA
CCAGCAGAATTACCAGAATAGTGAGAGTGGGGAAAAGAATGAGGGCTCGGAGAGTGCTCC
CGAAGGCCAGGCCCAACAGCGGCGGCCCTACCACAGGCAACGGTTCCCACCTTACTACAT
GCGGAGACCCTATTGGCGTCGACCACAGTATTCCAACCCTCCCATGCAAGAAGTGATGGA
GGGTGCTGACAACCAGGGTGCAGGAGAACAAGGTAGACGAGTGAGGCAGAATATGTATTG
GGGTTATAGACCACGATTCCGCAGGGGCCCTCCTGGCCAAAGACAGCCCAGAGAGGCTGG
CAATGAAGATAAGGAAAATCAAGGAGATGAGACCCAAGGTCAGCAGCCACCTCAACGTCG
GTACCACCGCAACTTCAATTACCGACACAGACACCCAGAAAACCCTAAACCACAAGATGG
CAAAGAGACAAAAGCAGCCGATCCACCAGCTGAGAACTCGTCCACTCCCAAGGCTGAGCA
GGGCCAAGATGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.0
SRP021940_embryo 0.53
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.16
SRP021940_testis 2.37

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGE-KGAEAAN-VTGPGGVPVQGSKYAADRNHYRRYPRRRGP
TKVLGTVKWFNVRNGYGFI.RNDT.EDVFVH.TAIK.NNPRK.LRS.GDGET.EFDV.EGE.KG......VTGPGGVP.QGSKYAAD.NHYRRYPRRRGP
Retrocopy
TKVLGTVKWFNVRNGYGFIKRNDTTEDVFVHHTAIK-NNPRKHLRSIGDGETLEFDVIEGE/KGCGGSK/VTGPGGVPEQGSKYAADLNHYRRYPRRRGP


Parental protein
PRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQ
PRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPY.R.RFPPYYMRRPY.RRPQYSNPP.Q.EVMEGADNQGAGEQGR.VRQNMY.GYRPRFRRGPP.QRQ
Retrocopy
PRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYHRQRFPPYYMRRPYWRRPQYSNPPMQ-EVMEGADNQGAGEQGRRVRQNMYWGYRPRFRRGPPGQRQ


Parental protein
PREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
PRE.GN.EDKENQGDETQGQQPPQRRY.RNFNYR.R.PENPKPQDGKETKAADPPAENSS.P.AEQG..E
Retrocopy
PREAGN-EDKENQGDETQGQQPPQRRYHRNFNYRHRHPENPKPQDGKETKAADPPAENSSTPKAEQGQDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide