RetrogeneDB ID:
retro_ecab_392
Organism:
Horse ( Equus_caballus )
Location:
17:25118571-25118819 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
84.52 %
Coverage:
97.65 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
UFM1
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-fold modifier 1 [Source:HGNC Symbol;Acc:20597]

Genomic region (view in browser)





>retro_ecab_392
GAGGTTTCCTTTAAAATCACGCTGACGTCAGACGGCGGCTCCCTTACAAAGTACTCAGTG
TTCCTGAAAGTACTCCTTTCACGGCAGTCTTAAAGCTTGCAGCAGAAGAATTTGAATTTC
CTACAGCAACAAATGCAATTATTACCAATGATGGAATAGGAATAAATCCTGTACAGACCA
CTGGAAATGTTTTCCCAAAGCATGGTTCAGAACTGCAAATTATTCCTAGAGATCGTGTTG
GAAGTTGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KVSFKITLTSDP-RLPYKVLSVPEGTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC
.VSFKITLTSD..RLPYKVLSVPE.TPFTAVLK.AAEEF..P.AT.AIITNDGIGINP.QT.GNVF.KHGSEL.IIPRDRVGSC
Retrocopy
EVSFKITLTSDG/RLPYKVLSVPESTPFTAVLKLAAEEFEFPTATNAIITNDGIGINPVQTTGNVFPKHGSELQIIPRDRVGSC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide