RetrogeneDB ID:
retro_ecab_398
Organism:
Horse ( Equus_caballus )
Location:
17:46660896-46661282 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.0 %
Coverage:
98.47 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS24
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S24 [Source:HGNC Symbol;Acc:10411]

Genomic region (view in browser)





>retro_ecab_398
AACGACACAGTAACTATCTGGACCCGGAAGTTCATGACCAACCGACTACTTCAGCAGAAA
CAATGGTCATAGATGTCCTTCACCCTGGGAAGGCAACAGTGCCTAAGACAGAAATTCGGG
AAAAACTAGCCAAAATGTACAAGACCACACCAGATGTCATCTTTGTATTTGGATTCAGAA
CCCATTTTGGTGGTGGGAAGACAACTGGCTCTGGCATGATTTATGATTCCTGGGATCACA
CAAAGAAAAATGAACCAAAACATAGACTTGCAAGACGTGGCCTGTATGAGAAGAAAAACA
CCTCAAGAAAACAACGGAAGGAACGCAAGAACAGAAGGAAGAGAGTCAGGGGGCCTGCAA
AGGCCAATGTCAGCGCTGGCAAAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.35
SRP021940_cerebellum 0.55
SRP021940_embryo 0.36
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.55
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NDTVTIRTRKFMTNRLLQRKQ-MVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKK
NDTVTI.TRKFMTNRLLQ.KQ.MVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTG.GMIYDS.D..KKNEPKHRLAR.GLYEKK
Retrocopy
NDTVTIWTRKFMTNRLLQQKQ/MVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGSGMIYDSWDHTKKNEPKHRLARRGLYEKK


Parental protein
KTSRKQRKERKNRMKKVRGTAKANVGAGKK
.TSRKQRKERKNR.K.VRG.AKANV.AGKK
Retrocopy
NTSRKQRKERKNRRKRVRGPAKANVSAGKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide