RetrogeneDB ID:
retro_ecab_40
Organism:
Horse ( Equus_caballus )
Location:
24:4193432-4194278 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
99.29 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_40
ATGGCCGTCAATGTGTACTCCACATCTGTGACCAGTGAGAATCTGAGTCGCCATGATATG
CTTGCTTGGGTCAATGACTCCCTGCACCTCAACTATACCAAGATAGAACAGCTCTGTTCA
GGGGCAGCCTACTGCCAGTTCATGGACATGCTCTTCCCTGGCTGTGTGCACTTGAGGAAG
GTAAAGTTCCAGGCCAAGCTAGAGCACGAATATATCCACAACTTCAAGGTGCTGCAAGCA
GCTTTCAAGAAGATGGGTGTTGACAAAATAATTCCTGTAGAGAAATTAGTGAAAGGAAAA
TTCCAAGATAATTTTGAGTTTATTCAGTGGTTTAAGAAATTCTTTGACGCAAACTATGAT
GGAAAGGATTACAACCCTCTGCTGGCGCGGCAGGGCCAGGACATAGCGCCACCTCCTAAC
CCAGGTGATCAGATCTTCAACAAATCCAAGAAACTCATTGGCACAGCAGTTCCACAGAGG
ACGTCCCCCACAGGCCCCAAAAATATGCAGACCTCTGGCCGACTGAGCAATGTGGCCCCA
CCCTGCATCCTCCGGAAGAATCCTCCATCAGCCCGAAATGGCGGCCATGAGACTGATGCC
CAAATTCTTGAACTCAACCAGCAGCTATTGGATTTGAAGCTGACAGTGGATGGACTAGAG
AAGGAACGTGACTTCTACTTCAGCAAACTTCGAGACATTGAGCTCATCTGCCAGGAACAC
GAAAGTGAGAACAGCCCTGTCATCTCGGGCATCATTGGCATTCTCTATGCCACTGAGGAA
GGATTTGCACCCCCTGAGGACGATGAGATTGAGGAACACCAACAAGAAGACCAGGACGAG
TACTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.8
SRP021940_cerebellum 13.79
SRP021940_embryo 1.89
SRP021940_placental_villous 1.16
SRP021940_synovial_membrane 0.83
SRP021940_testis 11.57

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGK
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGK
Retrocopy
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGK


Parental protein
FQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDA
FQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQD.APPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDA
Retrocopy
FQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDIAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDA


Parental protein
QILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIG-LYATEEGFAPPEDDEIEEHQQEDQDEY
QILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIG.LYATEEGFAPPEDDEIEEHQQEDQDEY
Retrocopy
QILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide