RetrogeneDB ID:
retro_ecab_405
Organism:
Horse ( Equus_caballus )
Location:
17:9735184-9735759 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.35 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL9
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L9 [Source:HGNC Symbol;Acc:10369]

Genomic region (view in browser)





>retro_ecab_405
ATGAAGACCATTCTCAGCAATCAGACTGTTGACATTTCAGAATATGTCAACATCTCTCTG
AAGGGACGCACAGTTATTGTGAAGGGCCCAAAGGAACACTGTGGAGGGACTTCAGTCACA
TCAATGTAGAACTCAGTCTCCGCGGGAAGAAAAAGAGGAGGCTCCGGGCTGATAAATGCT
GGGGAAATAGAAAGGAACTGGCTGATGCGGGCACTATCTTCAGTCACGTACAGAATGTGA
GGAAGGGTGTTACACGGGGCTTCCGTTACAAGCTGAGGTCTGTGTGTGCTCACTTCCCTA
TCAACGTGGTTATTCAGGAGAATGGGTCTCTTGTTGAGATCCGAAATTTCTTGGGTGAAA
AATACATCCGCAGGGTTCAGCTGAGGCCTGGGATTGCCTGTTCAGTATCTCAAGCCTAGA
AAGATGAGTTAATTCTTGAAGGAAACGACATTGAACTTGTTTCAGATTCAGCTGCTTTGA
CTGAGCATGCCACAACAGTTAAAAACAAGGATAGCAGAACATTTCTGGATGTTATCTATG
TTTCTGAGACAGAAACAGTTCAGCGGGTGGATGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.15
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKTILSNQTVDIPENVDITLKGRTVIVKGPR-GTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHF
MKTILSNQTVDI.E.V.I.LKGRTVIVKGP..GTL.RDF.HINVELSL.GKKK.RLR.DK.WGNRKELA...TI.SHVQN..KGVT.GFRYK.RSV.AHF
Retrocopy
MKTILSNQTVDISEYVNISLKGRTVIVKGPK/GTLWRDFSHINVELSLRGKKKRRLRADKCWGNRKELADAGTIFSHVQNVRKGVTRGFRYKLRSVCAHF


Parental protein
PINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
PINVVIQENGSLVEIRNFLGEKYIRRV..RPG.ACSVSQA.KDELILEGNDIELVS.SAAL...ATTVKNKD.R.FLD.IYVSE..TVQ..DE
Retrocopy
PINVVIQENGSLVEIRNFLGEKYIRRVQLRPGIACSVSQA*KDELILEGNDIELVSDSAALTEHATTVKNKDSRTFLDVIYVSETETVQRVDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide