RetrogeneDB ID:
retro_ecab_41
Organism:
Horse ( Equus_caballus )
Location:
11:45555241-45556576 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.3 %
Coverage:
74.14 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RTN4RL2
Parental gene aliases:
No gene alias available
Parental gene description:
reticulon 4 receptor-like 2 [Source:HGNC Symbol;Acc:23053]

Genomic region (view in browser)





>retro_ecab_41
CTCCCACCAGGGTGCTGTGTGGAACTGCTGCTGCTGCTGCTGGCCGGGGAGCTGCCCCTG
GGTGGCAGCTGCCCGCGGGACTGCGTGTGCTACCCAGCACCCATGACAGTCAGCTGCCAG
GCTCACAACTTCGATGCCATCCCTGAGGGCATCCCAGAGGACAGCGAGCGCATCTTCCTG
CAGAACAACCGCATCACCCTCCTCCAGAGGGGCCACTTCAGCCCCGCTATGGTCACCCTG
TGGATCTACTCCAACAACATCACCTTCATTGACCCCAGAACCTTCGAGGGCTTCGTGCAC
CTGGAGGAGCTGGACCTCGGCGACAACCGGCAGCTGCGGACGCTGGCACCCGAGACCTTC
CAGGGCCTGGTGAAGCTCCATGCCCTCTACCTCTATAAGTGTGGGCTCAGTGCCCTGCCA
GCGGGCATCTTTGGTGGCCTGCACAGCCTGCAGTACCTCTACCTGCAGGACAACCACATT
GAGTACCTCCAGGATGACATCTTTGTGGACCTGGTCAACCTCAGCCACCTGTTCCTCCAT
GGCAACAAGCTGTGGAGCCTGGGCCAGGACACCTTCCGGGGACTGGTGAACCTGGACCGG
CTGCTGCTGCATGAGAACCAGCTGCAGTGGGTCCACCACAGGGCTTTCCATGACCTCCGC
AGGCTGACCACCCTCTTCCTCTTCAACAACAGTCTCACTGAGCTGCAGGGTGACTGCCTG
GCACCCCTGGGGGCCCTGGAGTTCCTCCGGCTCAACGGGAATGCCTGGGACTGTGGCTGC
CGGGCACGCTCCCTGTGGGAATGGCTGCGGAGGTTCCGAGGCTCGAGCTCTGCCGTCCCC
TGTGCATCCCCCGAGCTGCGGCATGGCCAGGACCTGAAGCTGCTGCGGGCCGAGGACTTC
CGGAACTGCACGGGGCCAGCGTCCCCTCACCAGATCAAGTCGCACACGCTCACCACCACC
GACAGGGCCGCCCGCAAGGAACACCACCCACCCCACGGCCCCGCCAGGGACAAGGGCCAC
CCACGTGGCCATCTGCCTGGCTCCCGGCAGGGCTACAAGAAGCCAGGCAAGAACTGCACC
AGCCACAGGAATCGCAACCAGGTCTCGAAGGTGGGCGCCGGCAAGCAGGCCCACGAGCTG
CAGGACTACGCCCCCGACTACCAGCACAAGTTCGGCTTTGACATCATGCCCACGGCACGG
CCCAAGAGGAAGGGCAAGTGTGCCCGCAGGACCCCCATCCGTGCCCCCAGCGGGGTGCAG
CAGGCCTCCTCGGGCAGTTCCCTGGGGGCCTCATTCCTGGCCTGGATACTGGGGCTGGCA
ATCACTCTCCGCTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.57
SRP021940_cerebellum 13.29
SRP021940_embryo 2.49
SRP021940_placental_villous 0.76
SRP021940_synovial_membrane 2.89
SRP021940_testis 0.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PASACLLLMLLALP---PAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGPNLLTLWLFSNNLSTIYPGTFRHLQAL
P...C..L.LL.L....P...SCP..C.CY..P.TVSCQA.NF...P...P....R.FLQNN.I..L..G.F.P...TLW..SNN...I.P.TF.....L
Retrocopy
PPGCCVELLLLLLAGELPLGGSCPRDCVCYPAPMTVSCQAHNFDAIPEGIPEDSERIFLQNNRITLLQRGHFSPAMVTLWIYSNNITFIDPRTFEGFVHL


Parental protein
EELDLGDNRHLRSLEPDTFQGLERLQPMHHLTLQVSSLPLTNEDGILRINYLKLESNNFFTHKDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRL
EELDLGDNR.LR.L.P.TFQGL..L..........S.LP.....G.....YL.L..N......DD.F.DL.NLSHLFLHGN.L..L....FRGL..LDRL
Retrocopy
EELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGIFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQDTFRGLVNLDRL


Parental protein
LLHGNRLQGVHRAVFRGLSRL-TISTVNNSLS-LPGEALAEL-PLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALREADFQ
LLH.N.LQ.VH...F..L.RL.T....NNSL..L.G..LA.L..LEFLRLN.N.W.C.CRAR.LW.W..R.R.SSS.V.CA.P..R.G.DL..LR..DF.
Retrocopy
LLHENQLQWVHHRAFHDLRRLTTLFLFNNSLTELQGDCLAPLGALEFLRLNGNAWDCGCRARSLWEWLRRFRGSSSAVPCASPELRHGQDLKLLRAEDFR


Parental protein
ACP-PAAP
.C..PA.P
Retrocopy
NCTGPASP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide