RetrogeneDB ID:
retro_ecab_413
Organism:
Horse ( Equus_caballus )
Location:
17:31838547-31839750 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.49 %
Coverage:
62.29 %
Frameshifts:
7
Stop codons:
10


Parental gene:
Parental gene symbol:
DDX3X
Parental gene aliases:
No gene alias available
Parental gene description:
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked [Source:HGNC Symbol;Acc:2745]

Genomic region (view in browser)





>retro_ecab_413
TTTGCTGGCTCACACCTGAAGTCTTGAAGTAATCAGAGTGGAGGAAGTACAGCCATCAAG
GGGTGTATATTTCTCCTCACTTAAGGACAGAGAAGCTACAAAAGGAGTCTACGATGAAGA
CAGTTCAGGGTGGAATTCTAATAAAGATAAGGGTACCTAGAGCAGTTCTGAGTCTCATAG
TGATTCAAGAGAAAATTCCAGCTTCTTCAGTGATTGTGGAAGTGGATCAAGGGAGAAGTT
TGATGATCGTTGGGAGAGTGACTATGATGGCATTGGCAGTCATGGTGACACAAGTGGCTT
TGGCAAATTTGAACGTGGTGGAAACAGTCACAGTGTAACAAATCAGAGTAAGATGATTGG
CCAAAACCACTCTAACCAAGTGAATGCTTGGTACAGGGACTTTTTTCAGGAAATAACACT
GGGATTAACTTTGAGAAATACAATATTCCAATTGAGGCAATAGGCAACAACTATCCCCCA
CATACTGAAAGTGTCAGTGATGTTGAGATGGGAGAAATTATCATGGGAAACATAAAGCTT
ATTTGTTATACTCACCTGACTCCAGTGCAAAAGGATGCTATGATTATTATCAAAGAGAAA
ACACGCTTGATGACTTGTACCCAAACAGGGTCTGTAAAAACTACAGCATTTCTCTTGCCC
ATCTTGAGTTAGATTTATTCAGATAGTCCAGGAGAGACTTTGAGGGCCATAAAGGGGAAT
GGAAGGTAGGGGCGCTGCAAACAATCCCTAATATCCTAGGTATTAGCACCAAAGAGAGAA
TTGGCAGTACCGATCTGTGAAGAAGCCAGAAAATTTTCCTATCAATCTAGAGTTAGTCCT
TACATTGTATATGGTGGTGCTGATATTGGTCAACAGATGTGTGACTTAGAACATGGATGT
CACTTGTTAGTAGCCACTCTAGGAGGCCTAGTAGAAATGAGGTAAAGAGGAAATATTGGA
TAAGACTTCTGAAAATACATGGTGTTGGGTAAAGCTGATCTTATATTGGATGTGAGTTTT
GAAGCTCAGATAAGTAGAAAATTTAAACAAGTAGTATGCCACCAAAGGAAGTTCTCCACA
CTATGAGGGTTTAGTGCTACTTTCTCTAAGAAAAATACAGACGCTTGCTCATGATTTCTT
GGGTGAATATATCTTTTTGGCTGTGGGAAGATTGGCTTTACCTCTGAGAACATCACATAC
AAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FAGLDLNSSDNQSGGSTASKGR-YIPPHLR-NREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDR
FAG..L.S..NQSGGSTA.KG..YI.PHLR..REATKG.YD.DSSGW.S.KDK...SS..S.SDSR..SSFFSD.GSGSR..FDDR..SDYDGIGS.GD.
Retrocopy
FAGSHLKS*SNQSGGSTAIKGC/YISPHLR/DREATKGVYDEDSSGWNSNKDKGT*SSSESHSDSRENSSFFSDCGSGSREKFDDRWESDYDGIGSHGDT


Parental protein
SGFGKYERGGNSR-WCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIP
SGFGK.ERGGNS...C.KS..DDW.KPL.PSE.L.Q.LFSG.NTGINFEKY..IP.EA.GNN.PPH.ES.SDVEMGEIIMGNI.L..YT..TPVQK.A..
Retrocopy
SGFGKFERGGNSH/QCNKSE*DDWPKPL*PSECLVQGLFSGNNTGINFEKYN-IPIEAIGNNYPPHTESVSDVEMGEIIMGNIKLICYTHLTPVQKDAMI


Parental protein
IIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRD
IIKEK..LM.C.QTGS.KT.AFLLPILS.IYSD.PGE.LRA.K.NGR.GR.KQ..IS.VLAP.RELAV.I.EEARKFSY.SRV.P..VYGGADIGQQ..D
Retrocopy
IIKEKTRLMTCTQTGSVKTTAFLLPILS*IYSDSPGETLRAIKGNGR*GRCKQSLIS*VLAPKRELAVPICEEARKFSYQSRVSPYIVYGGADIGQQMCD


Parental protein
LERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQ-DTMPPKGVRHTMM-FSATFPK-EIQMLARDFLDEYIFLAVGR-V
LE.GCHLLVAT.G.LV.M..RG.IG.DF.KY.VL..AD..LD..FE.QI.R...Q...MPPK.V.HTM..FSATF.K..IQ.LA.DFL.EYIFLAVGR..
Retrocopy
LEHGCHLLVATLGGLVEMR*RGNIG*DF*KYMVLGKADLILDVSFEAQISRKFKQ/SSMPPKEVLHTMR\FSATFSK\KIQTLAHDFLGEYIFLAVGR/I


Parental protein
GSTSENITQK
G.TSENIT.K
Retrocopy
GFTSENITYK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide