RetrogeneDB ID:
retro_ecab_419
Organism:
Horse ( Equus_caballus )
Location:
17:40513731-40514898 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.92 %
Coverage:
89.93 %
Frameshifts:
6
Stop codons:
9


Parental gene:
Parental gene symbol:
EEF1G
Parental gene aliases:
No gene alias available
Parental gene description:
Elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:A2Q127]

Genomic region (view in browser)





>retro_ecab_419
ATGACAGCTGGGACCTTGTAGACATATCCTGAAAACTGGAAGGCCTTCCAGGCTCTGACA
GCCGCCCAGTACAGTGGAGCTCAGGTCCGTGTGCTGTCTGCACGATCCACTTCCAGTTCG
GCCAAACCAACTGCACCCCTGAATTTCTCCATAAATTTCCTACTGGCAAGTTTTCAGCAT
TTGAGGGTGATGACAGATTCTTGTGTTTGAGAGCGATGCCATTGTCTACCATACTAGCAA
TGAGGAGCTGCAGGGAAGTGCTTCAGAGGCAGCAGCCTCTGTGGTGCAGTGGATGAACTT
TGCTGATAGTAACATAGTACCCCCAGCCAGTACCTGATGGTTCCCCACCTTGAGCATCAT
GTACCACAATAAGCAGGCCACAGAGAACGCAAAGGAGGAGGTGAGGTGAATTCCGAGGTT
ATTAGATGCTCACTTGAAAATGAGGACTTTTCTGGTGGTGAACTGTGACACTGGCTGACG
TCACAGTTGTCTGCACTCTACTTTGGCTGTATAAACAGGCATTGGTGGCTTCTTTTCGCC
AGGCCTTTCCCAATACCAACTGCTGCTTCCTCATCTGCACTACCAGTTCCACTTCCGAGT
TGTCTTGGGAGAGGTGAAAATCTGTGAGAAGACGTCCCAGTTTGGTGCTAAAAAGTTTAC
AGATAGCCAGCTTTAAAAGGACACCCCATGGAAAGAGAAAGGTTCATGTGAGGAAAGCAG
AAGCCCCAGGCTGAGGAGGAAAAGGAGAAAAAGGTGGCTGCCCCTAGTCCCGAGGAGGAG
GTGGGTAAACGTGCAGGCTCTGTTTGCTGAACCAAAGGCCAAAGACCCCTTTGTTCATCT
GACCAAGAGTACGTTTGTGTCGGGTAAATTTAAATCAAGTACTCCAAAGATGACACAATC
TGTGACATTGCTGTATTTTGGGGACCACTTTGATAAGGATGGCTGATCCTTGTGATACTC
GAGGACTGCTTCCCTGAAGAACTCACCCAAACGTTCATGAGTTGCCTCATCATCACTGGA
GTGTTCCAGTGACTGGGCAAGCTGAGGAAGAATGCTTTTGCCAGTGTCACCCTCTTTGGA
ACCAACAATAGCAGCCCCATTTCAGGAGTTCAGATCTTCTGAGTCTAGGAGCTTGCCTTT
CCTGTGAGTCCAGATTGGCAGGTAGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPP-HFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFC-VFESNAIAYYVSNEELRGSTPEAAAQVVQW
M.AGTL.TYPENW.AF.AL.AAQYSGAQVRVLSA...HF.FGQTN.TPEFL.KFP.GK..AFEGDD.F..VFES.AI.Y..SNEEL.GS..EAAA.VVQW
Retrocopy
MTAGTL*TYPENWKAFQALTAAQYSGAQVRVLSARS/HFQFGQTNCTPEFLHKFPTGKFSAFEGDDRFL/VFESDAIVYHTSNEELQGSASEAAASVVQW


Parental protein
VSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLV-GE-RVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCIN
..FADS.IVPPAST..FPTL.IM.HNKQATENAKEEVR.I..LLDAHLK.RTFLV.GE..VTLAD.TVVCTLLWLYKQ.L..SFRQAFPNTN..FL.C..
Retrocopy
MNFADSNIVPPAST*WFPTLSIMYHNKQATENAKEEVR*IPRLLDAHLKMRTFLV/GE/TVTLADVTVVCTLLWLYKQALVASFRQAFPNTNCCFLICTT


Parental protein
-QPQFRAVLGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKR
.Q..FR.VLGEVK.CEK..QF.AKKF..SQ..KDTP.KEKGS.EE...P...RK..K......P........QAL.AEPKAKDPF.HL.KSTFV...FK.
Retrocopy
/QFHFRVVLGEVKICEKTSQFGAKKFTDSQL*KDTPWKEKGSCEESRSPRLRRKRRKRWLPLVPRRRWVNV-QALFAEPKAKDPFVHLTKSTFVSGKFKS


Parental protein
KYSNEDTLSVALPYFWEHFDKDGWSLWYS-EYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVD
......T.SV.L.YF..HFDKDG.SL.YS.E..FPEELTQTFMSC..ITG.FQ.L.KLRKNAFASV.LFGTNNSS.ISGV..F...ELAFP.SPDWQVD
Retrocopy
S-TPKMTQSVTLLYFGDHFDKDG*SL*YS/EDCFPEELTQTFMSCLIITGVFQ*LGKLRKNAFASVTLFGTNNSSPISGVQIF*V*ELAFPVSPDWQVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide