RetrogeneDB ID:
retro_ecab_421
Organism:
Horse ( Equus_caballus )
Location:
17:42933959-42934678 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.37 %
Coverage:
57.28 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
FLOT1
Parental gene aliases:
No gene alias available
Parental gene description:
flotillin 1 [Source:HGNC Symbol;Acc:3757]

Genomic region (view in browser)





>retro_ecab_421
CTGAAGGACACTCATGATCATCAGGACTATTTGCACTCCTTGGGGAAGGCTCTAACTTCT
CAAGTCCAAAATGATGTTCCTATTGGGGAGGTGGATGCCAAGAGAGATGCTGGGATCCAG
GAGGCCAAAGCCAAAAAGGAAAAGGTGAGTGCTCAGCACCTGAGTGAGATGGAGATGACC
AAGGGGCAGAGGGACTAGGAGCTGAGAAGGCTGTGTATGACATCAAAGTCACCACCAGCA
GCTTGAGCTGGACTGTCAGCTTCAGGTGGCCAAGACTAAGCAGCAGATGGAGGAAAAGTG
GGTACAGATGCAGGTGGTGGAGCAGGCACAGCAGGTGGCAGTGCAGGAGCCAGAGATCGC
ACACCGAGAGAAGGAGCTGGAGGTCCGAGTTCTGAAGCCAGTAGAAGTCTAGTGCTACAA
GCTGGAGCACCTAGCTGAGGCAGAAACGTCTCAGCTGATTCTGCAGGCAGACAGAAGCCG
AGTCTGTGCAGATGCGGGAGGATGCCAAGGCTTTGCCACAGAGATTGGAGCTCTGGGTCA
AGCTTGAGAAGATGGCCAAGAAGGCAGAAGAGTTCCAGCAGTACCTGGAGGCTGCTTGGC
TGGACATTCTGCTAGAGAAGCTGCCCCAGGTGGCAGAGATCAGTGGTACCTTGATCTTGG
CCAACAAGATCACATTGGGGTCCAGTGGAAGTGGGGCCGTGGGGGTGGCCAAAATGACC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELK-KAAYDIEVNT-RRAQADLAYQLQVAKTKQQ
LKD.HD.QDYLHSLGKA.T.QVQ.D..IGE..AKRDAGI.EAKAK.EKVSAQ.LSE.EM.K.QRD.EL..KA.YDI.V.T......D...Q..VAKTKQQ
Retrocopy
LKDTHDHQDYLHSLGKALTSQVQNDVPIGEVDAKRDAGIQEAKAKKEKVSAQHLSEMEMTKGQRD*ELR/KAVYDIKVTT/QQLELDCQLQ--VAKTKQQ


Parental protein
IEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKTQLIMQAEAEAESVRMRGEAEAFAIGARARADA-EQMSKKAEAFQL
.EE..VQ.QVVE.AQQVAVQE.EIA.REKELE.RV.KP.E...YKLE.LAEAE..QLI.QA..........G....FA....A...A.E.M.KKAE.FQ.
Retrocopy
MEEKWVQMQVVEQAQQVAVQEPEIAHREKELEVRVLKPVEV*CYKLEHLAEAETSQLILQAD-RSRVCADAGGCQGFATEIGALGQA\EKMAKKAEEFQQ


Parental protein
YQEAAQLDMLLEKLPQVAEEISGPLTSAKKITLVSSGSGTMGAAKVT
Y.EAA.LD.LLEKLPQVA.EISG.L..A.KITL.SSGSG..G.AK.T
Retrocopy
YLEAAWLDILLEKLPQVA-EISGTLILANKITLGSSGSGAVGVAKMT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide