RetrogeneDB ID:
retro_ecab_426
Organism:
Horse ( Equus_caballus )
Location:
18:10975357-10976407 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.29 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TMEM185B
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 185B [Source:RefSeq peptide;Acc:NP_001229250]

Genomic region (view in browser)





>retro_ecab_426
ATGAACCCCAGGGGCCTGTTCCAGGACTTCAACCCGAGTAAGTTTCTCATCTACGCCTGC
CTGCTGCTCTTCTCGGTGCTGCTGCCCCTCCGCCTGGACGGCATCATCCAGTGGAGCTAC
TGGGCTGTCTTCGCCCCCATATGGCTGTGGAAGCTCCTGGTCATCGCCGGTGCATCGGTG
GGCGCGGGCGTTTGGGCCCGAAACCCTCGCTACCGCGCCGAGGGGGAGGCGTGCGTGGAG
TTCAAAGCTATGTTGATCGCCGTGGGCATTCACCTGCTGCTGCTCATGTTCGAAGTCCTG
GTCTGCGACAGGGTGGAGAGGGGGACCCACTTCTGGCTGCTCGTCTTCATGCCGCTCTTT
TTCGTATCCCCCGTGTCCGTGGCCGCCTGCGTATGGGGCTTCCGACACGATAGATCGCTG
GAGCTGGAGCTCTTGTGCTCTGTCAACATCCTGCAGTTCATTTTCATCGCCCTGCGGCTG
GACAGGATTATCCACTGGCCGTGGCTAGTGGTGTTCGTGCCTCTGTGGATCCTCATGTCG
TTCCTTTGCCTGGTCGTCCTCTATTACATCGTCTGGTCTCTCCTGTTCTTGCGGTCCCTG
GATGTGGTTGCGGAACAGCGAAGAACACACGTGACCATGGCCATCAGCTGGATAACGATT
GTCGTGCCCTTGCTCACTTTTGAGGTTCTGCTGGTTCACAGATTGGATGGGCACAATACG
TTCTCTTATATCTCCATATTTGTCCCCCTTTGGCTTTCATTAATAACGTTAATGGCCACG
ACATTTAGGCGAAAAGGGGGCAACCATTGGTGGTTTGGTATTCGCAAAGATTTCTGTCAG
TTTCTGCTTGAAATTTTCCCATTTTTAAGAGAATATGGGAACATTTCATATGATCTACAT
CATGAAGATAGTGAAGATGCCGAAGAAACATCGGTTCCAGAAGTTCCTAAAATCGCTCCA
ATGTTTGGAAAGAAGGCCAGGGTAGTTATAACCCAGAGCCCTGGGAAATATGTTCCCCCA
CCTCCCAAGCTTAATATTGATATGCCAGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 14.93
SRP021940_cerebellum 8.11
SRP021940_embryo 21.18
SRP021940_placental_villous 13.15
SRP021940_synovial_membrane 13.65
SRP021940_testis 24.92

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVGTGVWARNPQYRAEGETCVEFKAMLIAVGIHLLLLMFEVL
MN.RGLFQDFNPSKFLIYACLLLFSVLL.LRLDGIIQWSYWAVFAPIWLWKL.VI.GASVG.GVWARNP.YRAEGE.CVEFKAMLIAVGIHLLLLMFEVL
Retrocopy
MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVIAGASVGAGVWARNPRYRAEGEACVEFKAMLIAVGIHLLLLMFEVL


Parental protein
VCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSM
VCDR.ERG.HFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELE.LCSVNILQFIFIALRLD.IIHWPWLVV.VPLWILMSFLCLVVLYYIVWS.LFLRS.
Retrocopy
VCDRVERGTHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELELLCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSL


Parental protein
DVIAEQRRTHITMALSWMTIVVPLLTFEILLVHKLDGHNAFSCIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH
DV.AEQRRTH.TMA.SW.TIVVPLLTFE.LLVH.LDGHN.FS.I.IFVPLWLSLITLMATTF..KGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH
Retrocopy
DVVAEQRRTHVTMAISWITIVVPLLTFEVLLVHRLDGHNTFSYISIFVPLWLSLITLMATTFRRKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH


Parental protein
HEDNEETEETPVPEPPKIAPMFRKKTRVVITQSPGKYVLPPPKLNIEMPD
HED.E..EET.VPE.PKIAPMF.KK.RVVITQSPGKYV.PPPKLNI.MPD
Retrocopy
HEDSEDAEETSVPEVPKIAPMFGKKARVVITQSPGKYVPPPPKLNIDMPD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide