RetrogeneDB ID:
retro_ecab_427
Organism:
Horse ( Equus_caballus )
Location:
18:14406043-14407398 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.73 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
NONO
Parental gene aliases:
No gene alias available
Parental gene description:
non-POU domain containing, octamer-binding [Source:HGNC Symbol;Acc:7871]

Genomic region (view in browser)





>retro_ecab_427
ATGCGGAGCAATAAAACCTTTAACTTGGAGAAGCAGAACCATACTCCAAGGAAGCATCAT
CAGCATCACCACCAGCAGCCACCACCGCCACGACCAATACCTGCAAATGGTCAACAAGCC
AGCAGCCAAAATGAAGGCTTGACTATTGACCTGAAGAATTTTAGGAAACCAGGAGAGATG
ACCTTCACCCAACGTATCCGGCTCTTTGTTGGCAATTTTCCTTCTGACATCACTGAGGAG
GAAATGAGGAAATTATTTGAGAAACATGGGAAGGCAGGCGAAGTCTTCATTCATAAGGAT
AAGGGCTTTGCCTTATCAGCTTGGAAACATGGGAGATTGCCAAAGTGGAGCTGGACAACA
TGCCACTCCAGGGAAAGCAGCTCTGTGTGTGCCTTGCCTGCCATAGCGGATCCCTTGCTG
TCTGAAACCTTCCTTAGTATGTATCCAACGATCTGCCAGAGGAAGCCTTTTCTGTGTCCG
TCCAGGTGGAGAGGGCTATAGTTGTTGTGGATGATCGAGGAAGGCCCTCAGGAAAAGGCA
TTGTTGAATTCTCAGGGAAGCCAGCTGCTTGGAAAGCTCTGGACAGATACAGTGAAGGCT
TCTTCCTGCTAACCACATTTCCTTGGCCTGTGACTTTAGAGCTCGTGGACCGGTTAGATG
ATGAAGAGGGACTTCCAGAGATTCTGGTTATAAAGAACAATCAATTTCACAATGAACAAG
AGCATCCACCCAGATTTGCACAGCCTGGCTCCTTTGAGTATGAGTATGCCATGCGCTGGA
ATGCACTCACTGAGGTGGAGAAGCAGCAGCAGGATCGAGTGGACCACAATATCAAGGAAG
CGCATGAGAAACTGGAGATGGAGATGCAGGCTACTTGCCATGAGCACCAGGTCATGCTAA
TGAGGCAGGATTTGATGAGGCGTCAAGAAGAACTTCAGAGGATGGAAGAGCTGCACAACC
AAGAAGTGCAAAAATGAAAGCAACTGGAGCTCAGGCAGGAGGAGGAGCACAGGTGCCGGG
AGGAAGAGATGAGGCAACAACAGGAAGGACTCAAGGGAAGCTTGCCTGACGCAAGAGAGC
AGGAGATATGACTGGACCAGTTGGCTATGGGAGGTGCTATGGGCATAAACAACAGAGACG
CCATGCCCCCTGCTCCTGTGCCTGCTGGTACTCCAGCTCCTCCAGGACCTGCCACTATGA
TGCCAAATGGAACCTTGGGATTGACCTCACCAACAACTGAAGGCTTTGGCCAACCTGCTA
CAACGGAAGGAATTGGGGCAATTGGTGGAACCCCTCCTGCATTCAACCATGCAGCTCCTG
GAGCAGAATTTGCTCCAAACAAACGTCATCGATAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.25
SRP021940_embryo 0.65
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.18
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQSNKTFNLEKQNHTPRKHHQHHHQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAG
M.SNKTFNLEKQNHTPRK....HHQ.HH...QQ.PPP.PIPANGQQASSQNEGLTIDLKNFRKPGE.TFTQR.RLFVGN.P.DITEEEMRKLFEK.GKAG
Retrocopy
MRSNKTFNLEKQNHTPRK----HHQHHH---QQPPPPRPIPANGQQASSQNEGLTIDLKNFRKPGEMTFTQRIRLFVGNFPSDITEEEMRKLFEKHGKAG


Parental protein
EVFIHKDKGFGF-IRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPA
EVFIHKDKGF...I.LET....EIAKVELDNMPL.GKQL.V..ACHS.SL.V.NLP.YVSN.L.EEAFSV..QVERA.V.VDDRGRPSGKGIVEFSGKPA
Retrocopy
EVFIHKDKGFAL/ISLETW---EIAKVELDNMPLQGKQLCVCLACHSGSLAV*NLP*YVSNDLPEEAFSVSVQVERAIVVVDDRGRPSGKGIVEFSGKPA


Parental protein
ARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
A.KALDR.SEG.FLLTTFP.PVT.E..D.LDDEEGLPE.LVIKN.QFH.E.E.PPRFAQPGSFEYEYAMRW.AL.E.EKQQQD.VD.NIKEA.EKL..EM
Retrocopy
AWKALDRYSEGFFLLTTFPWPVTLELVDRLDDEEGLPEILVIKNNQFHNEQEHPPRFAQPGSFEYEYAMRWNALTEVEKQQQDRVDHNIKEAHEKL--EM


Parental protein
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGA
E.....H......Q....RQ...RR.EEL..Q........E.........R.EE..R..EE.MR.QQEG.KG..PDAREQEI...Q.AMGGAMGINNR.A
Retrocopy
EMQATCHE----HQVMLMRQDLMRRQEEL--QRMEELHNQEVQK*KQLELRQEEEHRCREEEMRQQQEGLKGSLPDAREQEI*LDQLAMGGAMGINNRDA


Parental protein
MPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
MPPAPVPAGTPAPPGPATMMP.GTLGLT.PTTE.FGQ.AT.EGIGAIGGTPPAFN.AAPGAEFAPNKR.RY
Retrocopy
MPPAPVPAGTPAPPGPATMMPNGTLGLTSPTTEGFGQPATTEGIGAIGGTPPAFNHAAPGAEFAPNKRHRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide