RetrogeneDB ID:
retro_ecab_428
Organism:
Horse ( Equus_caballus )
Location:
18:21279203-21279966 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.99 %
Coverage:
58.94 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
RPL4
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L4 [Source:HGNC Symbol;Acc:10353]

Genomic region (view in browser)





>retro_ecab_428
TTGAGAAGATCGTGGCCTTCTCCTCTCCCCACCATCGTTTGTGCATGTCCACTGATATCA
GTGTACTCCAAAAAGGGGATCATCTGGCAAAAATGTCACTTGCCTGCTGTGTTCAAGGCT
CTCATTTGACCAGACACTGTGAACTTTGTTCACACCAAATTGCGCAAAAACAACAGACAG
CCTTGTGCTGTCAGTGAATTAGCAGGTCATCACACCACTGCTGAGTCTTGGAGTACTGGC
AAAGCTGTGGCTGGAACCCAAAGTTTGAGGTGATGGGACTCACAGTCTGGCCAGGGTGTT
TTCAGAAATACATGTTGTGGGAGCCAAATGTGTTCCCCAACCAAAACCTGGCTTGCTTGC
CACTGCAGAGTGAACACTACACTGAAGCAATAAGCCATCTGCTCTGTCCTGGCTTCCTCA
GTCTTACCAGCCCTGGTCATGACTAAAGATTATTGTATTTAGGAAGTTTCTGAACTTCCT
ATGATGGTTGAAGATAAAGTTGAAGGCTACAAGAAGACCAAGGAGGCTGTCTTGCTTCTT
AAGAAATTTAAGGCCTGGAATGATATAAAATATGTCTATGTCTATCAGCAAATGAGAGCA
GGTGAGGGCAGAATAAGAAGCCGCATCATATCCAGTTCAGGGGACCCTGCATCTTCTATA
ATGAGGACAACAGTATTATCAAGGCCTTTAGAAACATCCTGGAATTTCTCTGCTTAATGT
AAGCAAACTTAACATTTTGACACTTGCTCCTGGTGGACATGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRGAWPSPLPAMACARPLISVYS-EKGE-SSGKNVT-LPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHR
LR..WPSPLP...CA.PLISVYS..KG..SSGKNVT.LPAVFKA.I.PD.VNFVHT.LRKNNRQP.AVSELAGH.T.AESW.TG.AVA.....R......
Retrocopy
LRRSWPSPLPTIVCACPLISVYS/QKGD/SSGKNVT/LPAVFKALI*PDTVNFVHTKLRKNNRQPCAVSELAGHHTTAESWSTGKAVAGTQSLR*WDS-Q


Parental protein
SGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVESYKKTKEAVLLLKKLKAWNDIKKVYAS
SGQG.F.N.C.G..M..PTKTW...H.RVNTT.K..AICS.LA.S.LPALVM.K...I.EV.ELP..VEDKVE.YKKTKEAVLLLKK.KAWNDIK.VY..
Retrocopy
SGQGVFRNTCCGSQMCSPTKTWLACHCRVNTTLKQ*AICSVLASSVLPALVMTKDYCI*EVSELPMMVEDKVEGYKKTKEAVLLLKKFKAWNDIKYVYVY


Parental protein
QRMRAGKGKMRNR-RRIQRRGPCIIYNEDNGIIKAFRNI-PGITLLNVSKLNILKLAPGGHV
Q.MRAG.G..R.R...IQ.RGPCI.YNEDN.IIKAFRNI.PGI.LLNVSKLNIL.LAPGGHV
Retrocopy
QQMRAGEGRIRSR/HHIQFRGPCIFYNEDNSIIKAFRNI/PGISLLNVSKLNILTLAPGGHV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide