RetrogeneDB ID:
retro_ecab_431
Organism:
Horse ( Equus_caballus )
Location:
18:43281154-43281935 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.65 %
Coverage:
98.49 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFS3
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7710]

Genomic region (view in browser)





>retro_ecab_431
GCGGTGGCAGTGGCTAGGGGCTGGTGGTGGGGGCTCGTGGGGGCCGTGGCACTGGCCAGA
GTGGCCAGGCAACCCTTGGTACTGTTGCTGCCAGTGAGGATGGAAAGCACTTCAGTGGAC
ACGCGCCCCACTGTCAGACCATGGAATGATGTGGCCCACAGGCGGCTCTCAGCTTTTGGA
GAGTACGTGGCTGATATCCTGCCCAAATATGTCCACCAAGTTCAGGCGTCCTGCTTCAAT
GAGTTAGAGATCTGTATCCATCCTGAGGGATCATCCCAGTGCTGACTTTCCTCAGGGATC
ACACCAACGCACAATTCAAATCCCTGGCTGACCTGATGGCAGTGGACATCCCCACCCAGC
AGAACCATTTTGAGATTATTTACAACCTGTTCTCTCTGCGCTTCAACTCCCGGATCCCTG
TGAAGACCTACACAGATGAGCTGACGTCCATCGAGTCCACTGTCTCTGTGCACAAGGCAG
CCAACTGGTATGAGAGGGAAATCTGGGACATGTTTGGAGTCATCTTTGCTAACCACCCTG
ACCTAAGAAGGATCCTGACAGACTATGGCTTCCAGGGACATCCTTTCTGGGAAGACTTCC
CCTTGTCTGGCTATGTTGAGCTACGCTATGATGATAAGGTGAAGTGGGTGGTGGCTGAGC
TGGTGGAGTTGGCCCAAGAGTTCCCCAAGTTTGACCTGAACAGCCCATGGGAGGCTTTCC
CTGCCTATCTCCAGCCCCCTAGTATCTCAAGCTTGAAGCCGGAGATGAGAAACCTGAAAC
C

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAAAARGWWRGLVGTVALARAARRPSVLLLPVRTESAAADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEICIHPDG-VIPVLTFLR
A.A.ARGWW.GLVG.VALAR.AR.P.VLLLPVR.ES...DTRPTVRP.NDVAH..LSAFGEYVA.ILPKYV.QVQ.SCFNELEICIHP.G..IPVLTFLR
Retrocopy
AVAVARGWWWGLVGAVALARVARQPLVLLLPVRMESTSVDTRPTVRPWNDVAHRRLSAFGEYVADILPKYVHQVQASCFNELEICIHPEG/IIPVLTFLR


Parental protein
DHSNAQFKSLADLTAVDIPTRQNRFEIVYNLLSLRFNCRIRVKTYTDELTPIESAVSVHKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKD
DH.NAQFKSLADL.AVDIPT.QN.FEI.YNL.SLRFN.RI.VKTYTDELT.IES.VSVHKAANWYEREIWDMFGV.FANHPDLRRILTDYGF.GHPF..D
Retrocopy
DHTNAQFKSLADLMAVDIPTQQNHFEIIYNLFSLRFNSRIPVKTYTDELTSIESTVSVHKAANWYEREIWDMFGVIFANHPDLRRILTDYGFQGHPFWED


Parental protein
FPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPE-SLKLEAGDKKPET
FPLSGYVELRYDD.VK.VVAE.VELAQEF.KFDLNSPWEAFPAY.QPP...LKLEAGD.KPET
Retrocopy
FPLSGYVELRYDDKVKWVVAELVELAQEFPKFDLNSPWEAFPAYLQPPS/YLKLEAGDEKPET


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide