RetrogeneDB ID:
retro_ecab_439
Organism:
Horse ( Equus_caballus )
Location:
18:974344-975240 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.0 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
SDCBP
Parental gene aliases:
No gene alias available
Parental gene description:
syndecan binding protein (syntenin) [Source:RefSeq peptide;Acc:NP_001229406]

Genomic region (view in browser)





>retro_ecab_439
ATGTCTCTGTACCCATCTCTTGAAGACCTGAAGGTAGACAAAGTAATTCAGGCTCAACTG
CCTATTCTGCAAACCCTGCCAACCCAGCAGTTTTGTCTGAAGCTTCTGCTCCTCCCATCT
CTCAAGATGGAAATCTCTATCCTAAGCTGTATCCAGAGCTCTCTCAGTACATGGGCCTGA
GTTTAAATGATGAAGAAATACGTGCAAATATGGCCATGGTCCCTGGAGCACCAATTCAGG
GACAATTGGTAGCAAGACCTTCCAGTAAGAACTATATGATGGCTCCTGTAACTGGCAATG
ATGTTGGGATTCGTAGAGCAGAAATTAAGCAAGGGATTCGTGAAGTCATCCTGTGTAAGG
ATCAAGATGGAAAAATTGGGCTCAGGCTTAAAGCAAGAGACAACGGAATATTTGTTCAGC
TAGCCCAGGCAAATTCTCCAGCCTCGCTGGTTGGCCTGAGGTTTGGGGACCAAGTACTCC
AGATCAACGGGGAAAACTGTGCAGGCTGGAGCTCTGATAAATCGCACAAGGTGCTCAAAC
AGGATTTTGGAGAGAAGATTACTATGACTATTCGTGACAGGCCCTTCGAATGAACAATTA
CCATGCATAAGGATAGTACTGGACATGTTGGTTTTATCTTTAAAAATGGAAAAATAACAT
CCGTAGTGAAAGATAGTTCTGCAGCCAGAAATGGTCTCCTCACAGAACATAACATCTGTG
AGATCAATGGACAGAATGTCATTGGGCTGAAGGACTCTCAAATTGCAGGCATACTGTCAA
CATCTGAGACTGTGGTTACTATTACAATCATGCCTGCTTTTATCTTTGAACATATTATTA
AACGGATGGCACCAAGCATTATGAAAAGCCTGATGGATCACACCATTCCTGAGATT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.29
SRP021940_cerebellum 0.2
SRP021940_embryo 0.41
SRP021940_placental_villous 0.67
SRP021940_synovial_membrane 0.42
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLYPSLEDLKVDKVIQAQ-TAYSANPANPAVLSEASAPPVSQDGNLYPKLYPELSQYMGLSLNDEEIRANMAMIPGAPIQGQLVARPSSMNYMVAPVTG
MSLYPSLEDLKVDKVIQAQ.TAYSANPANPAVLSEASAPP.SQDGNLYPKLYPELSQYMGLSLNDEEIRANMAM.PGAPIQGQLVARPSS.NYM.APVTG
Retrocopy
MSLYPSLEDLKVDKVIQAQ/TAYSANPANPAVLSEASAPPISQDGNLYPKLYPELSQYMGLSLNDEEIRANMAMVPGAPIQGQLVARPSSKNYMMAPVTG


Parental protein
NDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGVFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKSHKVLKQAFGEKITMTIRDRPFERT
NDVGIRRAEIKQGIREVILCKDQDGKIGLRLK..DNG.FVQL.QANSPASLVGLRFGDQVLQINGENCAGWSSDKSHKVLKQ.FGEKITMTIRDRPFE.T
Retrocopy
NDVGIRRAEIKQGIREVILCKDQDGKIGLRLKARDNGIFVQLAQANSPASLVGLRFGDQVLQINGENCAGWSSDKSHKVLKQDFGEKITMTIRDRPFE*T


Parental protein
ITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
ITMHKDSTGHVGFIFKNGKITS.VKDSSAARNGLLTEHNICEINGQNVIGLKDSQIA.ILSTS.TVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPE.
Retrocopy
ITMHKDSTGHVGFIFKNGKITSVVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIAGILSTSETVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide