RetrogeneDB ID:
retro_ecab_445
Organism:
Horse ( Equus_caballus )
Location:
18:33567783-33568367 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
67.84 %
Coverage:
75.38 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
NSA2
Parental gene aliases:
No gene alias available
Parental gene description:
NSA2 ribosome biogenesis homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:30728]

Genomic region (view in browser)





>retro_ecab_445
ACTACCAAGATGCATGAAAAGAGAAATACCAAACAAAAGAATGATGAAAAGACTCCACAG
GAACAGTACCTATCTATCTGCTGGACACAGAGGGACAGTCTGGAGCTAAAATACTTTCAA
ATATGGTTAAACAAAAACAAAAAGAAAAAGCAGGAATAAGGAAAGACCTTCTACCCAAGG
TTCACGCTCAGGGAGAAACAAATCTTAAAAGTTATTTGAACAGGAAAAGAGAAAGAACAA
AGCATCAAAGAGGTTGGTTACTAAAGCCTGCTCTGTTGGAAATGGCTTTTTGTGAAAACC
ACCTAAATATGAAAGATTCATTAGGCCAATGGGCTTATGTTTCAAGGCGGCCCATGTAAT
ATATTCTGAAATCAAAGTCACCTTTTGCCTGTAAATACACGGTGTAAAGAAAAATCTTTT
GTCTCCACTATATACAACTTTTGGGTATTACTACCAAAGATATGGTCATTGAGGTGAATG
TGAGCAAGTGAGGCCTTGTGAAAGGAGACAAGGTTATTCGGGGGCAATATGCCTAGGTTA
CTAACAATCATGAAAATGACGGATGCATAAATGTAGTCTTATTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TIKMHEKRNTKQKNDEKTPQ-GAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVL-KVIRTGKRKKKAWKRMVTKVCFVGDGFT
T.KMHEKRNTKQKNDEKTPQ.G.VP.YLLD.EGQS.AK.LSNM........AG.....LPKV.AQGET....K.....KRK.KA.KR.VTK.C.VG.GF.
Retrocopy
TTKMHEKRNTKQKNDEKTPQ/GTVPIYLLDTEGQSGAKILSNMVXXXXXXXAGIRKDLLPKVHAQGETNLK/KLFEQEKRKNKASKRLVTKACSVGNGFL


Parental protein
RKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTT-LGVITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLL
.KPPKYERFIRPMGL.FK.AHV...E.K.TFCL.I.GVKKN..SPLYTT.LG..TK..VIEVNVS..GLV..G.KVI.G.YA.VTNN.ENDGCIN.VLL
Retrocopy
*KPPKYERFIRPMGLCFKAAHVIYSEIKVTFCL*IHGVKKNLLSPLYTT\LGITTKDMVIEVNVSK*GLV-KGDKVIRGQYA*VTNNHENDGCINVVLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide