RetrogeneDB ID:
retro_ecab_449
Organism:
Horse ( Equus_caballus )
Location:
18:51153754-51154079 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.5 %
Coverage:
58.15 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
PDAP1
Parental gene aliases:
No gene alias available
Parental gene description:
PDGFA associated protein 1 [Source:HGNC Symbol;Acc:14634]

Genomic region (view in browser)





>retro_ecab_449
AAAGGTATAGAAGAGCTCATCAACATCGAGAACCCCAAATGGGTGGCAGAGACAATCAGA
AAGGTCATACAACTGGATCTAGACAGGCCAAGGAGCTTTGAAGGAAAAAACAAGACGACA
CTGAGAAGAGAAAGCAAGAACATTTCATGAAAATCCATTTAGCTGGGAAGACAGAGCAGG
CCAAGGCTATCTCGCCCGGGTGACAGTCATTCGGAAGTAGCAGCAAGAGGGGCAGGAGGC
TGCCAGGAAGAAAAAAGAAGAGAGGAAAGCAAAAGGTGATGCAACTTTGTCAGGAAATCT
AATGCAGTTGCTCACCCTGAATAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.05
SRP021940_embryo 0.17
SRP021940_placental_villous 0.76
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGVEGLIDIENPNRVAQTTKKVTQLDLDGP-KELSRREREEIEKQKAKERYMKMHLAGKTEQAKAD-LARLAIIRK---QREEAARKKEEERKAKDDATL
KG.E.LI.IENP..VA.T..KV.QLDLD.P.KEL.R......EK.K..E..MK.HLAGKTEQAKA..LAR...IRK......EAARKK.EERKAK.DATL
Retrocopy
KGIEELINIENPKWVAETIRKVIQLDLDRP/KEL*RKKQDDTEKRK-QEHFMKIHLAGKTEQAKAI/LARVTVIRK*QQEGQEAARKKKEERKAKGDATL


Parental protein
SGKRMQSLSLNK
SG..MQ.L.LN.
Retrocopy
SGNLMQLLTLNR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide