RetrogeneDB ID:
retro_ecab_45
Organism:
Horse ( Equus_caballus )
Location:
1:157071057-157071372 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.19 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Enhancer of rudimentary homolog [Source:UniProtKB/TrEMBL;Acc:F7AUD4]

Genomic region (view in browser)





>retro_ecab_45
ATGTCTCACACCGTTCTGCTGGTACAGCCTACTGAGAGGCCAGAAGGCCGCACTTACGCT
GACTATGAGTCTGTGAATGAATGCATGGAAGGCGTTTGTAAAATGTCTGAAGAACATCTG
AAGAGAATGAACCCCAACAGCCCCTCTATCACATACGATATCAGTCAGTTGTTTGATTTT
ATCGATGATCTGGCAGACCGCAGCTGCCTTGTTTACCGAGCTGCTACCCAGACATACCAG
CCTTATAACAAAGACTGGATTAAAGAGAAGATCTACGTGCTCCTTCGTCGGCAGGCCCAA
CAGGCTGGGAAATAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 2.28
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ
MSHT.LLVQPT.RPEGRTYADYESVNECMEGVCKM.EEHLKRMNPNSPSITYDISQLFDFIDDLAD.SCLVYRA.TQTYQPYNKDWIKEKIYVLLRRQAQ
Retrocopy
MSHTVLLVQPTERPEGRTYADYESVNECMEGVCKMSEEHLKRMNPNSPSITYDISQLFDFIDDLADRSCLVYRAATQTYQPYNKDWIKEKIYVLLRRQAQ


Parental protein
QAGK
QAGK
Retrocopy
QAGK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide