RetrogeneDB ID:
retro_ecab_454
Organism:
Horse ( Equus_caballus )
Location:
18:70248343-70248886 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.36 %
Coverage:
68.12 %
Frameshifts:
0
Stop codons:
4


Parental gene:
Parental gene symbol:
ACAA2
Parental gene aliases:
No gene alias available
Parental gene description:
acetyl-CoA acyltransferase 2 [Source:HGNC Symbol;Acc:83]

Genomic region (view in browser)





>retro_ecab_454
TTGAGCCAGGCTCCCTGCTGAGCCAGAAACTAGTGTGTTAGAACCATGTTTGGATCAGAT
CTCAAGCTGGAAGATTCTTCGGGAGCAGCGTTAGCAGATTCCCAACTCACCATGGGAATT
ACTGCAGAGAATTTTGCAAAACATAAAATAAGCAGACAAGGATGTAATGAATACACCCTG
TGGTCACAGCAGAGGCTGAAAGCTGCTAATGATGCTGGTTACTTCAATAATAAGATGGTA
CCAATCAAAGTGAAGACAAGGAAAGGAAAACAGCCAATGCAAGTAGGTGAGCATGCTTGT
CCCTGAGCAAGCCTGGAGCAGTTAAATAAACTTTGGCCAATATTCAAGATAAAAGGGACT
GCCACTGCAAGGAGTATATTGGGAGCATCTGATGCTTTCATAGCTAGTGAAGATGCTGGT
AAAAAACGTAACTTCACACCACTGACAAGAATTGTGGGCTATTTTGTATCTGAATGTGAT
CCTTCTATGATGGATATCTGTCTTGTCCCTGCTATCAATGGAGCACTATAGAAAATAAGA
CTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSQAPFCVRNVRFGTRFGSDLKLEDTLWTSLTDTHVQLTMAITAENLAVKHKISREDCDKYALQSQQRWKAANDAGYFNNEMAPIEVKTKKGKQIMQVDE
.SQAP...RN....T.FGSDLKLED.....L.D...QLTM.ITAEN.A.KHKISR..C..Y.L.SQQR.KAANDAGYFNN.M.PI.VKT.KGKQ.MQV.E
Retrocopy
LSQAPC*ARN*CVRTMFGSDLKLEDSSGAALADS--QLTMGITAENFA-KHKISRQGCNEYTLWSQQRLKAANDAGYFNNKMVPIKVKTRKGKQPMQVGE


Parental protein
HARPQTTLEQLSKLPPVFKKEGTVTAGNASGVCDGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSLMGIGPVPAINGALKKTGL
HA.P...LEQL.KL.P.FK..GT.TA....G..D......IASEDA.KK.NFTPL.RIVGYFVS.CDPS.M.I..VPAINGAL.K..L
Retrocopy
HACP*ASLEQLNKLWPIFKIKGTATARSILGASD----AFIASEDAGKKRNFTPLTRIVGYFVSECDPSMMDICLVPAINGAL*KIRL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide