RetrogeneDB ID:
retro_ecab_459
Organism:
Horse ( Equus_caballus )
Location:
19:21723649-21724128 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
90.12 %
Coverage:
59.26 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RNF115
Parental gene aliases:
No gene alias available
Parental gene description:
ring finger protein 115 [Source:HGNC Symbol;Acc:18154]

Genomic region (view in browser)





>retro_ecab_459
ATAATACAACGGATCTTTGAAGGATTCTTTGCAAATTCTGCAATTCCTGGATCCCTACAC
CCTTTCACCTGGAGCGGGATGCTGCACTCCAACCCTGGGGACTATGCCTGGGGTCAGACA
GGGCTCGATGCCATTGTAACCCAGCTTTTAGGACAAGTGGAAAATACAGGGCCTCCCCCA
GCTGACAAGGAAAAGATCACATCTCTTCCAACAGTGACAGTAACTCAGGAACAAGTTGAC
ATGGGTTTAGAGTGTCCAGTATATAAAGAAGATTACACAGGTGAAGAGGAAGTCTGGCAG
TTACCCTGCAAACACTTCTTCCACAGCAGTTGTATTGTGCCGTGGTTAGAATTGCATGAC
GCATGTGCTGTATGTAGGAAGAGCTTAAATGGTGAGGACTCTGCTCGGCAAACCCAGAGC
TCTGAGGCCTCTGCAAGCAACAGATTTAGCGACAGCCAGCACATGACTGATGGACTTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.35
SRP021940_embryo 0.26
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.18
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IIQQIFAGFFANSAIPGP-HPFTWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQ
IIQ.IF.GFFANSAIPG..HPFTWSGMLHSNPGDYAWGQTGLDAIVTQLLGQ.ENTGPPPADKEKITSLPTVTVTQEQVDMGLECPV.KEDYT.EEEV.Q
Retrocopy
IIQRIFEGFFANSAIPGSLHPFTWSGMLHSNPGDYAWGQTGLDAIVTQLLGQVENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVYKEDYTGEEEVWQ


Parental protein
LPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQTQSSEASASNRFSSDSQ-LHDRWTF
LPC.HFFHSSCIVPWLELHD.C.VCRKSLNGEDS.RQTQSSEASASNRF.SDSQ..HD.WTF
Retrocopy
LPCKHFFHSSCIVPWLELHDACAVCRKSLNGEDSARQTQSSEASASNRF-SDSQ/AHD*WTF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide