RetrogeneDB ID:
retro_ecab_46
Organism:
Horse ( Equus_caballus )
Location:
4:51359377-51360262 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.28 %
Coverage:
99.66 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RPSA
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_46
TCCGGAGCCCTTGACATCCTGCAAATGAAGGAGGAGGATGTCCTCAAATTCCTTGCAGCA
GGAACACACTTAGGTGGCACCAACCTTGACTTCCAGATGGAACAGTACATCTACAAAAGG
CAAAGTGATGGCATCTACGTCACAAATTTGAAGAGAACCTGGGAGAAGCTACTGCTGGCA
GCTCGTGCCATTGTAGCCATTGAAAACCCAGCTGACGTCAGTGTCATATCCTCCAGGAAT
ACTGACCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCACTGGAGCCACTCCTATTGCTGGC
CGCTTCACTCCTGGAACCTTCACTAACCAGATCCAGGCAGCCTTCCGGGAACCGAGACTT
CTGGTGGTAACTGATCCCAGGGCTGACCACCAGCCTCTCACAGAGGCGTCTTATGTCAAC
CTGCCTACCATTGCTCTGTGTAACACAGACTCTCCCCTGCGCTATGTGGACATCGCCATC
CCATGCAACAATAAGGGAGCTCACTCTGTGGGTCTGATGTGGTGGATGCTTGCCCGGGAA
GTTCTGCGCATGCGGGGTACCATCTCCAGTGAACACCCATGGGAGGTCATGCCTGATCTC
TACTTCTACAGAGATCCTGAAGAGATTGAAAAGGAAGAGCAGGCTGCTGCCGAAAAAGCT
GTGACCAAGGAGGAATTTCAGGGTGAATGGACTGCTCCTGCTCCTGAGTTCACTGCTACT
CAACCTGAGGTTGCAGACTGGTCTGAAGGTGCGCAGGTGCCCTCTGTGCCTATTCAGCAG
TTCCCTACTGAAGACTGGAGTGCTCAGCCTGCCGCTGAAGACTGGTCTGCAGCTCCCACT
GCTCAGGCCACTGAGTGGGTAGGAACAACCACTGAGTGGTCTTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.7
SRP021940_cerebellum 0.25
SRP021940_embryo 0.98
SRP021940_placental_villous 0.4
SRP021940_synovial_membrane 1.9
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAG
SGALD.LQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKR.SDGIY..NLKRTWEKLLLAARAIVAIENPADVSVISSRNT.QRAVLKFAAATGATPIAG
Retrocopy
SGALDILQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRQSDGIYVTNLKRTWEKLLLAARAIVAIENPADVSVISSRNTDQRAVLKFAAATGATPIAG


Parental protein
RFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDL
RFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTIS.EHPWEVMPDL
Retrocopy
RFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISSEHPWEVMPDL


Parental protein
YFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGTTTEWS
YFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEG.QVPSVPIQQFPTEDWSAQPA.EDWSAAPTAQATEWVGTTTEWS
Retrocopy
YFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGAQVPSVPIQQFPTEDWSAQPAAEDWSAAPTAQATEWVGTTTEWS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide