RetrogeneDB ID:
retro_ecab_460
Organism:
Horse ( Equus_caballus )
Location:
19:22019873-22020449 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.59 %
Coverage:
55.78 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
KHDRBS3
Parental gene aliases:
No gene alias available
Parental gene description:
KH domain containing, RNA binding, signal transduction associated 3 [Source:HGNC Symbol;Acc:18117]

Genomic region (view in browser)





>retro_ecab_460
TTCCTCATTCCTGACTATAATGATGACCTCAGGCAAGCACACCTCCAGGAATTAACATAT
TTGAATGGTGGCTCAGAAAATGCAGATGTACCCATTGTTTGAGGGAAATCCACCTTGCAT
ACAAGAGGTATCCTAACCCCAGCAATAACCAGGGGAAGGGGAGGAGTCACGGCCCAGCAG
GGTGGAGTTGGTGTGCCACAAGGGATGCCAACTTCCAGGGGAGTCCTTTCCACCAGAGGG
CCAGTGCATCAGGGAAGAGGACTGCTCACTCCCAGAGCAAGAGGAGTGCCCCCAACTGGG
CAGACCTCCACAGCCAGCCCCAACACAAGAGACCTATGGAGATTATGACTATGATGTGGA
TATGACACTGCTTATGATGAACAGAGTTATGATTCCTATGATGACAGCTATAGCACCCCA
GCCCAAAGTGGTGCTGATGACTATGATTATGGACATGGAGTCAGTGAAGAGACTTATGAT
TCCCATGGGCAAGAGGAGTGGCCTAACTCAAGACACAAGGCACCTTCAGCGAGGACAGCA
AAGGGCATCTACAGAGACCATCCCTATGGCAGATAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRGVPTPAITRGRGGVTARPVGVGVPRGTPTSRGVLSTRGPVSRGRGLLTPRARGVPPTG
FLIPDYND..RQA.LQELTYLNGGSENADVP.V.GKSTL.TRG..TPAITRGRGGVTA...GVGVP.G.PTSRGVLSTRGPV..GRGLLTPRARGVPPTG
Retrocopy
FLIPDYNDDLRQAHLQELTYLNGGSENADVPIV*GKSTLHTRGILTPAITRGRGGVTAQQGGVGVPQGMPTSRGVLSTRGPVHQGRGLLTPRARGVPPTG


Parental protein
YR-PPPPPPTQETYGDYDYD-DGYGTAYDEQSYDSYDNSYSTPVQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
...P.P..PTQETYGDYDYD..GY.TAYDEQSYDSYD.SYSTP.QSGAD.YDYGHG.SEETYDS.GQEEW.NSRHKAPSARTAKG.YRD.PYGRY
Retrocopy
QT\PQP-APTQETYGDYDYD/CGYDTAYDEQSYDSYDDSYSTPAQSGADDYDYGHGVSEETYDSHGQEEWPNSRHKAPSARTAKGIYRDHPYGRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide