RetrogeneDB ID:
retro_ecab_463
Organism:
Horse ( Equus_caballus )
Location:
19:37753942-37754335 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.15 %
Coverage:
96.32 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
ATP5G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Source:HGNC Symbol;Acc:841]

Genomic region (view in browser)





>retro_ecab_463
ACCAAGGCACTACTCATTCCTCTGGCTCTGATCTACTGCGGTACTTGGGTCTGATCAGGC
CTGTGTCTGCCTCCTTCTGAGGAGGCCAGAGATCCCATCTAAAGAGACTTCCTACAGCAG
CTCCACGCTTTAGGTGGTCCAGTGGGAGTTGCAGACCAATATTGTCTCCTAGGACATTGA
CACAGTGGCTAAGCTTATTGCTGCTGGAGTCACCACAGTTGGTGTAGCTGGTTCAAAGGC
CAGCATTGGAACAGTGTTTGATAGCTTGACCATTGGGTATGCCAGGATCCTGTCCCTCAA
ACAGGATCTCTTTCTTCTATGCCTGTTCTGGGCTTTGCCCTGTCTGACGCCGTGGAGCTC
TTCTGTTTGATGGTTGCATTCTTCACTCTCTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TGALLIPPALIRCCT-RGLIRPVSASF-LSRPEIPSNQPSYSSSPFQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP
T.ALLIP.ALI.C.T..GLIRPVSASF.L.RPEIPS...SYSSS...V...E.QT..VS.DIDT.AK.I.AG..TVGVAGS.A.IGTVF.SL.IGYAR..
Retrocopy
TKALLIPLALIYCGT/LGLIRPVSASF/LRRPEIPSKETSYSSSTL*VVQWELQTNIVS*DIDTVAKLIAAGVTTVGVAGSKASIGTVFDSLTIGYARIL


Parental protein
SLKQQL-FSYAILG-FALSEAMGLFCLMVAFLILF
SLKQ.L.F.YA..G.FALS.A..LFCLMVAF..LF
Retrocopy
SLKQDL\FFYACSG\FALSDAVELFCLMVAFFTLF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide