RetrogeneDB ID:
retro_ecab_465
Organism:
Horse ( Equus_caballus )
Location:
19:55825384-55826006 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.24 %
Coverage:
73.61 %
Frameshifts:
4
Stop codons:
6


Parental gene:
Parental gene symbol:
NSMCE4A
Parental gene aliases:
No gene alias available
Parental gene description:
non-SMC element 4 homolog A (S. cerevisiae) [Source:HGNC Symbol;Acc:25935]

Genomic region (view in browser)





>retro_ecab_465
AATCTGCTACCAGTTGAAGAATTCTTCATGGTGAAGATACTTGTGATTTCAAATTCGTAG
TCTATGACTCCAGTGCAATATCAGAACATGCCTTTAGTACAACCCACATATTACATGTCC
TGTTGGATTCAACACAGTAAGAATTCCTTGCATCGATGCCATGAACTGATCATTCAACAA
AAGTTCCTGTTATGTAAGAGGAGGAGGCAATGTCTGCATGTTAGGAAGAATGAAACAATC
TCATCAAGAAGCAAAACAAAAAGAAGTAGAAATAATCTTGGAATTTTTAAAAACATATTT
TTAAGAAGACCCTAAAACTCCTTTGTCCTTCCATGACTTTGTGGCTGATCCACATTTTTT
CCATGCACTTTGAAAACCAAATTCATTATATTCCTTCATTATGAAAAATGGTTTTGCAAG
AAGAAGTCATGACCAAAACAAACTTCTAATAAAAAGTCTTGTTAATATTAACTAACAAAG
CAAGAAAGTTGACTTAAACATCAAAACTAGGAATCAAGAAATTATAGCTTTGAGTTATTG
AGACTGGAAGGAAATTGTGAAGATTTTTGAAATTTCGCTCCCTGCAATCACTTCAAATCA
AAGTCAGCAAAGACTAACTTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NPLEAEE-LIRDEDSSDFEFIVYDSWKISGKTAENTFNKTHTFHFLLGSIQGEFPVPKPRTDRPRKVPMIEQRREMPA-QLKRMEESHQEATEKEVERIL
N.L..EE.....ED..DF.F.VYDS..IS....E..F..TH..H.LL.S.Q.EF....P.TD...KVP.......M.A..L.RM..SHQEA..KEVE.IL
Retrocopy
NLLPVEE/ILHGEDTCDFKFVVYDSSAIS----EHAFSTTHILHVLLDSTQ*EFLASMP*TDHSTKVPVM*EEEAMSA/MLGRMKQSHQEAKQKEVEIIL


Parental protein
GLLQTYFREDPDTPMSFFDFVIDPHSF-PRTVENIFHV-SFIIRDGFARIRLDQDRLPIIEPVNINEESEGIDQNTQIRNQGIIALSYRDWEEIVKTFEI
..L.TYF.EDP.TP.SF.DFV.DPH.F.P.T....F...SFI...GFAR...DQ..L.I...VNIN..S...D.N...RNQ.IIALSY.DW.EIVK.FEI
Retrocopy
EFLKTYF*EDPKTPLSFHDFVADPHFF/PCTLKTKFII\SFIMKNGFARRSHDQNKLLIKSLVNIN*QSKKVDLNIKTRNQEIIALSY*DWKEIVKIFEI


Parental protein
SEPVIASGQSQQRLSA
S.P.I.S.QSQQRL..
Retrocopy
SLPAITSNQSQQRLTS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide