RetrogeneDB ID:
retro_ecab_467
Organism:
Horse ( Equus_caballus )
Location:
19:1156176-1156740 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
89.42 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PRELID1
Parental gene aliases:
No gene alias available
Parental gene description:
PRELI domain containing 1 [Source:HGNC Symbol;Acc:30255]

Genomic region (view in browser)





>retro_ecab_467
AGCAAACATGTCTCGATGGAGACAGTACACCGGGAGGTGACCCCTGACCAGAAGCTCCTG
TCCCGGCGACTCCTGACCAAGACCAACAGGATGCCCCGCTGGGCCGAGCGACTGTTTCCT
GCCAATGTTGCTCACTCAGTGTACATCCTGGAGGATTCTATTGTGGACCCACAGAACCAG
ATCATGACCACCTTCATCTGGAACGTCAACCATGCCCAGCTGATGGTGGTGGAGGAACGA
TGTGTTTACTGTCTGAACTCTGATAACAGTGGCTGGACCGAAATCCTCCAGGAAGCCTGG
GTCTCCTCTAGCTTATTTGGCATCTCCAGAGCTGTCCAGGAATTTGGTCTGGCCCGGTTC
AAAAGCAACGTGACCAAGACTATGAAGGGTTTTGAGTACATCTTGGCCAAGCTGCAAGGC
GAGGCTCCTTCCAAATCCCTTGTGGAGACAGCCAAGGAAGCCAAGGAGAAGGCAAGGGAG
ACGGCACTGGCAGCTACGGAGAAGGCCAAGGACCTTGCCAGCAAGGCCGCCACCAAGAAG
CAGCAGCAGCAGCAGCAGTTCGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.63
SRP021940_cerebellum 4.03
SRP021940_embryo 2.54
SRP021940_placental_villous 4.07
SRP021940_synovial_membrane 2.11
SRP021940_testis 1.78

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREA
SKHV..E..VHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYILEDSIVDPQNQ.MTTF.WN.NHA.LMVVEERCVYC.NSDNSGWTEI..EA
Retrocopy
SKHVSMET-VHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYILEDSIVDPQNQIMTTFIWNVNHAQLMVVEERCVYCLNSDNSGWTEILQEA


Parental protein
WVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKSLVETAKEAKEKARETALAATEKAKDLASKAANKKQQQQQQFV
WVSSSLFG.SRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKSLVETAKEAKEKARETALAATEKAKDLASKAA.K.......FV
Retrocopy
WVSSSLFGISRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKSLVETAKEAKEKARETALAATEKAKDLASKAATKXXXXXXXFV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide