RetrogeneDB ID:
retro_ecab_472
Organism:
Horse ( Equus_caballus )
Location:
19:19699165-19699743 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
90.72 %
Coverage:
91.47 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
NUDT4
Parental gene aliases:
No gene alias available
Parental gene description:
nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Source:HGNC Symbol;Acc:8051]

Genomic region (view in browser)





>retro_ecab_472
CGGCGGCAGCCGGAGCAGCAGCGGCAGCAAGGGCCCGCCTCTATGATGAAGTTCAAGCCC
AACCAGACGCGGACCTACGACCACGAGGGCTTCAAGAAGCGGGCAGTGTGCCTGTGCTTC
CGGAGCGAGCAAGAGGACGAGGTGCTGTTGGTGAGAAGCAGTCCGTACCCAGACCAATGG
ATTGTCCCAGGAGGAGGCGGGGAGCCCGATGAGGAGCCTGGCGGTGCTGCGGTGAGGGAG
GTTTATGAAGACGCTGGGTCAAAGGAAAATTAGGCAGACTCCTGGGCATATTTGAGAACC
AAGACCGAAAGCACAGGACATATGTTTATGTTCTTACTGTCACTGAAATATTAGAAGATT
GGGAAGATTCTGTTAATAGAGGAAGGAAGAGAGAGTGGTTCAAAGTTGAAGATGCTATCA
AAGTTCTCCAGTGTCATAAGCCTGTACATGCAGAGTATCTGGAAAAACTAAAGCTGAGGT
GTTCTCCATCCAATGACAATTCCACTGTCCCTTCCCCTCCAGATAATAACACCTTGTTTG
TAACTGCTGCACAGACCCCTGGGTTGCCATCTAGTATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.1
SRP021940_embryo 0.55
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.13
SRP021940_testis 1.13

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RRRMEQQRHQEPASMMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAG-VKGKLGRLLGIFE
RR..EQQR.Q.PASMMKFKPNQTRTYD.EGFKKRA.CLCFRSEQEDEVLLV.SS.YPDQWIVPGGG.EP.EEPGGAAVREVYE.AG.VKGKLGRLLGIFE
Retrocopy
RRQPEQQRQQGPASMMKFKPNQTRTYDHEGFKKRAVCLCFRSEQEDEVLLVRSSPYPDQWIVPGGGGEPDEEPGGAAVREVYEDAG/VKGKLGRLLGIFE


Parental protein
NQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIRVLQCHKPVHAEYLQKLKLGCSPSNGNSTVPSLPDNNTLFVTAAQTPGLPSSI
NQDRKHRTYVYVLTVTEILEDWEDSVN.GRKREWFKVEDAI.VLQCHKPVHAEYL.KLKL.CSPSN.NSTVPS.PDNNTLFVTAAQTPGLPSSI
Retrocopy
NQDRKHRTYVYVLTVTEILEDWEDSVNRGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLRCSPSNDNSTVPSPPDNNTLFVTAAQTPGLPSSI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide