RetrogeneDB ID:
retro_ecab_477
Organism:
Horse ( Equus_caballus )
Location:
19:48397426-48397768 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
96.49 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PPDPF
Parental gene aliases:
No gene alias available
Parental gene description:
pancreatic progenitor cell differentiation and proliferation factor homolog (zebrafish) [Source:HGNC Symbol;Acc:16142]

Genomic region (view in browser)





>retro_ecab_477
ATGGCAGCCATCCCCTCCAGCGGCTCACTCGTGGCCACCCACGACTACTACCGGCGCCGC
CTGGGTTCCACTTCCAGCAACAGCTCCTGCGGCAGCGCCGAGTACCCTGGGGAAGCCATC
CCCCACCACCCCGGTCTCCCCAAGGCCGACCCGGGTCACTGGTGGGCGAGCTTCTTTTCT
GGGAAGTCCACTCTCCCGTTCATGACCACAGTGTTGGAGTCCCCAGAGCACTCGGAGTCC
CCCCAGGCCTCCAGCAGCACCATCACGTGTGACCTGGCTCCAGAAGCCTCGAGGAAGCAG
CCTGGTGGCCAGCCTGCCAAAGCCAATGCTGGGCCCCGGTCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 4.59
SRP021940_cerebellum 3.34
SRP021940_embryo 6.13
SRP021940_placental_villous 2.41
SRP021940_synovial_membrane 2.27
SRP021940_testis 8.54

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAIPSS-SLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWWTSFFFGKSTLPFMATVLESPEHSESPQASSSTITCDLAPEASRKQ
MAAIPSS.SLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWW.SFF.GKSTLPFM.TVLESPEHSESPQASSSTITCDLAPEASRKQ
Retrocopy
MAAIPSSGSLVATHDYYRRRLGSTSSNSSCGSAEYPGEAIPHHPGLPKADPGHWWASFFSGKSTLPFMTTVLESPEHSESPQASSSTITCDLAPEASRKQ


Parental protein
PGGQPAKANAGPRS
PGGQPAKANAGPRS
Retrocopy
PGGQPAKANAGPRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide