RetrogeneDB ID:
retro_ecab_479
Organism:
Horse ( Equus_caballus )
Location:
19:56737353-56737850 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.01 %
Coverage:
99.4 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
C2orf68
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 2 open reading frame 68 [Source:HGNC Symbol;Acc:34353]

Genomic region (view in browser)





>retro_ecab_479
GAAGCGGCGCGGGATCCCAGGCCGGGGCTCTGCTGCAAGCCTGGCGGGCGGCTGGACATG
AGTCAGGGCTTCGTGCACCATATCCGAAGGAACCAGCTCGCCCGGGACGACTACGACAAG
AAGGTGAAGCAGGCTGCCCAAGGAGAAGGCAAGGAGGCGGCGCACGCCCCGCGCCGACGC
GGCCCCGCAAGCCCGACCTGCAGGTGTACCTGCCGCGACGCCGAGGTGTCTCTACCCACC
CAAGCAACCCAGACTGTGAGGAGTCCGGTGAAAGCAGCAGTAGTGGTGGTTCCGAGCCAG
AACCTTCTGGCCATCAGCTCTTCTGCGTAGAATATGAGGCAGACAGCGGAGAGGTCACCT
CAGTTATCGTGTATCAGGACGATGATCCAGAAAGGGTGAGTGAGGAGGTGTCAACACACA
TGCCTCTGGATCCACCCATGCGAGAGGCCCTCAAGTTGCGCATCCAGGAAGAGATTGCAA
AGCGCCAGAGCCGATAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EAAPEPRPGLCCKPGGRLDMSHGFVHHIRRNQLARDDYDKKVKQAA-KEKARRRHTP-APTRPRKPDLQVYLPRRRDVSTHPSNPDCEESGESSSSGGSE
EAA..PRPGLCCKPGGRLDMS.GFVHHIRRNQLARDDYDKKVKQAA.KEKARRR.TP.APTRPRKPDLQVYLPRRR.VSTHPSNPDCEESGESSSSGGSE
Retrocopy
EAARDPRPGLCCKPGGRLDMSQGFVHHIRRNQLARDDYDKKVKQAA\KEKARRRRTP\APTRPRKPDLQVYLPRRRGVSTHPSNPDCEESGESSSSGGSE


Parental protein
PEPSGHQLFCLEYEADSGEVTSVIVYQDDDPERVSEEVSTHTPLDPPMREALKLRIQEEIAKRQSRH
PEPSGHQLFC.EYEADSGEVTSVIVYQDDDPERVSEEVSTH.PLDPPMREALKLRIQEEIAKRQSR.
Retrocopy
PEPSGHQLFCVEYEADSGEVTSVIVYQDDDPERVSEEVSTHMPLDPPMREALKLRIQEEIAKRQSRY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide